Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C7H7

Protein Details
Accession I1C7H7   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-38ELTLHKPKAVHRKGSRLKKKRKRRDGKTEEAEVNBasic
NLS Segment(s)
PositionSequence
10-31KPKAVHRKGSRLKKKRKRRDGK
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MGVVELTLHKPKAVHRKGSRLKKKRKRRDGKTEEAEVNSRVGTRSYKCTFFRIKCRDSKSNPNLYYKATYLYNQIIHHLLSPQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.62
4 0.71
5 0.81
6 0.85
7 0.84
8 0.88
9 0.88
10 0.93
11 0.93
12 0.94
13 0.94
14 0.94
15 0.94
16 0.92
17 0.92
18 0.87
19 0.81
20 0.72
21 0.63
22 0.54
23 0.43
24 0.34
25 0.24
26 0.17
27 0.12
28 0.11
29 0.11
30 0.11
31 0.18
32 0.2
33 0.26
34 0.27
35 0.32
36 0.4
37 0.42
38 0.51
39 0.52
40 0.55
41 0.58
42 0.64
43 0.67
44 0.65
45 0.72
46 0.7
47 0.72
48 0.7
49 0.69
50 0.63
51 0.58
52 0.55
53 0.44
54 0.39
55 0.3
56 0.28
57 0.26
58 0.28
59 0.29
60 0.26
61 0.28
62 0.26
63 0.24
64 0.25