Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C241

Protein Details
Accession I1C241   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-30VKHTIVKKRTAHFKRHQSNRFMRVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPAVKHTIVKKRTAHFKRHQSNRFMRVGESWRKPKGIDCNMRRRFKGQAPMPKIGYGSAKKTRNLLPNGFRKFTVSNVRELNLLLMHNRSYAAEIAHNVSSKKRVALLERAAQLNVKVINAGARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.71
4 0.71
5 0.78
6 0.81
7 0.84
8 0.85
9 0.83
10 0.85
11 0.82
12 0.77
13 0.67
14 0.58
15 0.53
16 0.53
17 0.52
18 0.51
19 0.51
20 0.49
21 0.49
22 0.48
23 0.48
24 0.5
25 0.51
26 0.53
27 0.54
28 0.62
29 0.7
30 0.75
31 0.71
32 0.63
33 0.6
34 0.55
35 0.57
36 0.53
37 0.54
38 0.55
39 0.57
40 0.56
41 0.5
42 0.44
43 0.35
44 0.33
45 0.25
46 0.25
47 0.29
48 0.31
49 0.31
50 0.34
51 0.39
52 0.4
53 0.43
54 0.42
55 0.42
56 0.47
57 0.51
58 0.49
59 0.43
60 0.39
61 0.35
62 0.35
63 0.37
64 0.29
65 0.3
66 0.3
67 0.31
68 0.29
69 0.28
70 0.24
71 0.15
72 0.14
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.09
79 0.09
80 0.1
81 0.1
82 0.1
83 0.11
84 0.13
85 0.15
86 0.16
87 0.15
88 0.17
89 0.2
90 0.2
91 0.2
92 0.21
93 0.23
94 0.27
95 0.35
96 0.39
97 0.42
98 0.44
99 0.44
100 0.4
101 0.38
102 0.33
103 0.29
104 0.23
105 0.17
106 0.13
107 0.12
108 0.15
109 0.16
110 0.18
111 0.16