Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BQS0

Protein Details
Accession I1BQS0   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-98QSSQGESRRGRKKRTREEDYTSDSLHydrophilic
NLS Segment(s)
PositionSequence
81-87RRGRKKR
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito_nucl 11.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024610  ING_N_histone-binding  
Pfam View protein in Pfam  
PF12998  ING  
Amino Acid Sequences MTAEEKKKTLDTIGQMLNEVIKRGEEKYALAKSTYDTVDRHCTKLDDDLQKIEDEQMIGSTRVSEQTPTAEKGQSSQGESRRGRKKRTREEDYTSDSLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.29
5 0.23
6 0.2
7 0.14
8 0.11
9 0.13
10 0.13
11 0.16
12 0.13
13 0.15
14 0.2
15 0.23
16 0.23
17 0.22
18 0.21
19 0.19
20 0.22
21 0.22
22 0.17
23 0.14
24 0.17
25 0.26
26 0.27
27 0.27
28 0.25
29 0.25
30 0.23
31 0.28
32 0.31
33 0.27
34 0.27
35 0.27
36 0.27
37 0.26
38 0.25
39 0.2
40 0.13
41 0.08
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.09
51 0.09
52 0.08
53 0.12
54 0.15
55 0.17
56 0.19
57 0.19
58 0.19
59 0.2
60 0.26
61 0.23
62 0.24
63 0.28
64 0.31
65 0.39
66 0.43
67 0.5
68 0.55
69 0.6
70 0.66
71 0.7
72 0.76
73 0.78
74 0.85
75 0.85
76 0.83
77 0.84
78 0.82
79 0.8
80 0.74