Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BIQ2

Protein Details
Accession I1BIQ2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-82SAPFKGFKKKSSKEKSPINKLSPHydrophilic
NLS Segment(s)
PositionSequence
67-70KKKS
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MNRKKKLILDLSAQEGSSTKKPRINTLGSQAIQEKVPLQEDFDNNFQSPIKSTFNYVPSSAPFKGFKKKSSKEKSPINKLSPIFLGVDRANGCQVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.27
4 0.27
5 0.29
6 0.27
7 0.3
8 0.32
9 0.39
10 0.45
11 0.47
12 0.44
13 0.47
14 0.5
15 0.47
16 0.47
17 0.41
18 0.35
19 0.29
20 0.25
21 0.19
22 0.12
23 0.14
24 0.12
25 0.13
26 0.15
27 0.17
28 0.2
29 0.2
30 0.21
31 0.18
32 0.19
33 0.17
34 0.14
35 0.14
36 0.14
37 0.15
38 0.13
39 0.16
40 0.19
41 0.21
42 0.23
43 0.22
44 0.2
45 0.19
46 0.24
47 0.22
48 0.21
49 0.22
50 0.24
51 0.33
52 0.35
53 0.41
54 0.47
55 0.54
56 0.63
57 0.69
58 0.75
59 0.74
60 0.81
61 0.84
62 0.85
63 0.85
64 0.79
65 0.76
66 0.67
67 0.61
68 0.52
69 0.43
70 0.35
71 0.26
72 0.26
73 0.19
74 0.24
75 0.22
76 0.22
77 0.22