Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C5S5

Protein Details
Accession I1C5S5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-96LATKNGRHTLNRRRMKGRKNLSHHydrophilic
NLS Segment(s)
PositionSequence
64-93RKRRHGFLARLATKNGRHTLNRRRMKGRKN
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFGQLWTTATTRFASLARPNTMGSSILSSSLGAFRNPLTTAFNTTTQMRFISRGNTYQPSQLVRKRRHGFLARLATKNGRHTLNRRRMKGRKNLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.3
4 0.31
5 0.31
6 0.31
7 0.31
8 0.31
9 0.26
10 0.2
11 0.17
12 0.14
13 0.13
14 0.12
15 0.11
16 0.1
17 0.12
18 0.12
19 0.09
20 0.1
21 0.09
22 0.11
23 0.12
24 0.12
25 0.12
26 0.12
27 0.16
28 0.18
29 0.19
30 0.19
31 0.2
32 0.19
33 0.17
34 0.17
35 0.13
36 0.13
37 0.12
38 0.15
39 0.15
40 0.16
41 0.19
42 0.22
43 0.22
44 0.23
45 0.25
46 0.24
47 0.29
48 0.32
49 0.38
50 0.41
51 0.5
52 0.53
53 0.54
54 0.6
55 0.61
56 0.6
57 0.6
58 0.65
59 0.6
60 0.57
61 0.57
62 0.53
63 0.5
64 0.51
65 0.47
66 0.41
67 0.42
68 0.49
69 0.58
70 0.63
71 0.69
72 0.7
73 0.76
74 0.8
75 0.83
76 0.85