Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RGZ3

Protein Details
Accession E3RGZ3   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-109GDKTKAKVKKPVTPRKRKSKGDAAGBasic
111-134GEEVTPTKRGRKKKSEEKQVVAAEHydrophilic
NLS Segment(s)
PositionSequence
87-125KTKAKVKKPVTPRKRKSKGDAAGEGEEVTPTKRGRKKKS
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
KEGG pte:PTT_07130  -  
Amino Acid Sequences MSDTEKASTTPNGKGWTDRQRLAYYFSLVEHSNVKLDFLTAPRPSGKTVGACRIMVDRLKGTLKADLAALRGEADNEGQGHDAAGDKTKAKVKKPVTPRKRKSKGDAAGEGEEVTPTKRGRKKKSEEKQVVAAEEVVQVEGGVEVKDEVGDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.48
4 0.51
5 0.5
6 0.51
7 0.5
8 0.5
9 0.51
10 0.45
11 0.37
12 0.31
13 0.28
14 0.25
15 0.21
16 0.21
17 0.18
18 0.16
19 0.16
20 0.15
21 0.15
22 0.12
23 0.13
24 0.13
25 0.13
26 0.18
27 0.16
28 0.18
29 0.2
30 0.21
31 0.22
32 0.22
33 0.23
34 0.22
35 0.25
36 0.29
37 0.3
38 0.28
39 0.28
40 0.27
41 0.28
42 0.23
43 0.21
44 0.15
45 0.15
46 0.17
47 0.17
48 0.16
49 0.16
50 0.15
51 0.14
52 0.14
53 0.12
54 0.11
55 0.1
56 0.09
57 0.07
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.07
74 0.1
75 0.16
76 0.2
77 0.22
78 0.3
79 0.34
80 0.41
81 0.52
82 0.61
83 0.66
84 0.74
85 0.81
86 0.83
87 0.88
88 0.87
89 0.84
90 0.83
91 0.8
92 0.76
93 0.72
94 0.65
95 0.56
96 0.5
97 0.42
98 0.32
99 0.24
100 0.17
101 0.12
102 0.12
103 0.12
104 0.2
105 0.27
106 0.37
107 0.47
108 0.57
109 0.67
110 0.74
111 0.84
112 0.86
113 0.89
114 0.84
115 0.82
116 0.75
117 0.66
118 0.56
119 0.46
120 0.35
121 0.27
122 0.22
123 0.13
124 0.1
125 0.08
126 0.07
127 0.07
128 0.07
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06