Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CL06

Protein Details
Accession I1CL06    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-38VQQVTQPTSNKKRNNKPRPKRPASGDAHHydrophilic
NLS Segment(s)
PositionSequence
21-32KKRNNKPRPKRP
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MVDHVKLQRTVQQVTQPTSNKKRNNKPRPKRPASGDAHSTSLPSTNGSSSQADNSNVTQTSSKGFQQRYATKKTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.46
4 0.5
5 0.57
6 0.62
7 0.63
8 0.68
9 0.75
10 0.79
11 0.85
12 0.88
13 0.89
14 0.91
15 0.94
16 0.91
17 0.87
18 0.82
19 0.8
20 0.75
21 0.68
22 0.62
23 0.52
24 0.47
25 0.4
26 0.33
27 0.23
28 0.19
29 0.14
30 0.1
31 0.1
32 0.08
33 0.09
34 0.12
35 0.13
36 0.12
37 0.15
38 0.17
39 0.17
40 0.18
41 0.18
42 0.19
43 0.18
44 0.19
45 0.17
46 0.15
47 0.17
48 0.18
49 0.22
50 0.26
51 0.28
52 0.33
53 0.41
54 0.5
55 0.53