Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BYW1

Protein Details
Accession I1BYW1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
112-136RKVIEIKSRKFRKLRNNLKRGNVIAHydrophilic
NLS Segment(s)
PositionSequence
119-126SRKFRKLR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MGAVLDVTSKAMKPQVERKSIKFRGTVYTDGVGVSVLKQNHDTKKKGDSSGGKSKSNEADEFPYVEKLGKEGLLAGVGKCILLGPDRRYLFYCMHEKSTVENKMIYRYTSNRKVIEIKSRKFRKLRNNLKRGNVIAAELSLSHLKSSTVNKDRFVEYLQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.49
4 0.54
5 0.59
6 0.66
7 0.7
8 0.68
9 0.63
10 0.56
11 0.54
12 0.54
13 0.49
14 0.41
15 0.36
16 0.31
17 0.27
18 0.24
19 0.17
20 0.12
21 0.1
22 0.11
23 0.1
24 0.11
25 0.16
26 0.22
27 0.31
28 0.38
29 0.4
30 0.39
31 0.47
32 0.51
33 0.49
34 0.5
35 0.48
36 0.5
37 0.57
38 0.58
39 0.53
40 0.49
41 0.51
42 0.48
43 0.44
44 0.37
45 0.29
46 0.28
47 0.25
48 0.26
49 0.23
50 0.19
51 0.16
52 0.16
53 0.13
54 0.1
55 0.1
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.07
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.04
68 0.04
69 0.05
70 0.09
71 0.11
72 0.18
73 0.19
74 0.2
75 0.22
76 0.25
77 0.25
78 0.26
79 0.29
80 0.24
81 0.27
82 0.27
83 0.25
84 0.26
85 0.33
86 0.31
87 0.26
88 0.27
89 0.25
90 0.29
91 0.3
92 0.27
93 0.23
94 0.26
95 0.34
96 0.4
97 0.45
98 0.41
99 0.43
100 0.48
101 0.48
102 0.53
103 0.54
104 0.52
105 0.57
106 0.63
107 0.68
108 0.69
109 0.73
110 0.74
111 0.75
112 0.8
113 0.81
114 0.84
115 0.83
116 0.84
117 0.82
118 0.73
119 0.66
120 0.55
121 0.45
122 0.36
123 0.28
124 0.21
125 0.15
126 0.15
127 0.12
128 0.12
129 0.11
130 0.1
131 0.11
132 0.15
133 0.21
134 0.29
135 0.37
136 0.4
137 0.44
138 0.47
139 0.48
140 0.46