Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CSU1

Protein Details
Accession I1CSU1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-44ELTFRKPKAVQKKTSGTKKRKKDTGKADEAEHydrophilic
NLS Segment(s)
PositionSequence
18-36RKPKAVQKKTSGTKKRKKD
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MPEANKKKRLCVVELTFRKPKAVQKKTSGTKKRKKDTGKADEAEVNARVDSRGYKAAYLPPYSPFLNPIELFWSKIKGNIRKDCLGADDNLRLRITETANKATQQYCANWISHSQSFFDGCLVLEPTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.64
4 0.6
5 0.58
6 0.52
7 0.53
8 0.54
9 0.56
10 0.57
11 0.59
12 0.69
13 0.75
14 0.83
15 0.84
16 0.84
17 0.84
18 0.86
19 0.87
20 0.86
21 0.85
22 0.84
23 0.84
24 0.84
25 0.83
26 0.74
27 0.67
28 0.6
29 0.52
30 0.44
31 0.34
32 0.24
33 0.15
34 0.14
35 0.11
36 0.09
37 0.1
38 0.1
39 0.13
40 0.13
41 0.13
42 0.14
43 0.19
44 0.22
45 0.22
46 0.21
47 0.18
48 0.21
49 0.21
50 0.2
51 0.17
52 0.15
53 0.16
54 0.15
55 0.14
56 0.16
57 0.15
58 0.17
59 0.16
60 0.17
61 0.15
62 0.19
63 0.26
64 0.29
65 0.37
66 0.42
67 0.47
68 0.46
69 0.47
70 0.44
71 0.4
72 0.34
73 0.27
74 0.23
75 0.23
76 0.23
77 0.24
78 0.23
79 0.2
80 0.19
81 0.21
82 0.22
83 0.23
84 0.26
85 0.29
86 0.3
87 0.31
88 0.33
89 0.3
90 0.31
91 0.28
92 0.25
93 0.25
94 0.26
95 0.26
96 0.24
97 0.26
98 0.29
99 0.29
100 0.28
101 0.24
102 0.24
103 0.25
104 0.24
105 0.22
106 0.16
107 0.12
108 0.14