Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C895

Protein Details
Accession I1C895   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-52IIALRKSVPKSDKRKKREVNSRIADHydrophilic
109-130PQQPKAKKVNKAKLRIEKRNAEHydrophilic
NLS Segment(s)
PositionSequence
32-44RKSVPKSDKRKKR
113-127KAKKVNKAKLRIEKR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSTPEENITLSDLLEKHKEEHKQLTSKIIALRKSVPKSDKRKKREVNSRIADLEYNLRAKQEEEIRVLKAKEAGIDPSEQQTEDEDGISLERLNNLTIESDGTKVQELPQQPKAKKVNKAKLRIEKRNAEMERLREEAEKEAANQVDQGALETDAIKELLTPMNLRIKQITADGHW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.29
5 0.34
6 0.36
7 0.44
8 0.49
9 0.52
10 0.53
11 0.57
12 0.52
13 0.5
14 0.5
15 0.46
16 0.4
17 0.36
18 0.42
19 0.43
20 0.46
21 0.5
22 0.51
23 0.56
24 0.64
25 0.72
26 0.75
27 0.74
28 0.81
29 0.83
30 0.86
31 0.88
32 0.85
33 0.85
34 0.8
35 0.76
36 0.67
37 0.58
38 0.48
39 0.38
40 0.33
41 0.25
42 0.22
43 0.17
44 0.16
45 0.16
46 0.16
47 0.19
48 0.21
49 0.22
50 0.24
51 0.25
52 0.27
53 0.3
54 0.29
55 0.25
56 0.22
57 0.18
58 0.16
59 0.15
60 0.15
61 0.13
62 0.14
63 0.13
64 0.13
65 0.13
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.09
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.09
93 0.12
94 0.14
95 0.19
96 0.26
97 0.34
98 0.34
99 0.43
100 0.51
101 0.54
102 0.6
103 0.65
104 0.68
105 0.68
106 0.77
107 0.78
108 0.8
109 0.83
110 0.83
111 0.8
112 0.78
113 0.73
114 0.74
115 0.66
116 0.62
117 0.56
118 0.5
119 0.47
120 0.41
121 0.38
122 0.3
123 0.3
124 0.27
125 0.26
126 0.22
127 0.19
128 0.22
129 0.21
130 0.19
131 0.18
132 0.15
133 0.13
134 0.12
135 0.12
136 0.09
137 0.08
138 0.09
139 0.09
140 0.09
141 0.08
142 0.09
143 0.07
144 0.06
145 0.08
146 0.11
147 0.12
148 0.13
149 0.16
150 0.26
151 0.27
152 0.29
153 0.3
154 0.28
155 0.29
156 0.32