Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C6S7

Protein Details
Accession I1C6S7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-54DVSKAHRRQPKRLYEKKGKKGHPGBasic
NLS Segment(s)
PositionSequence
34-53KAHRRQPKRLYEKKGKKGHP
Subcellular Location(s) extr 17, E.R. 4, golg 3, vacu 2
Family & Domain DBs
Amino Acid Sequences MYCTWLLFCLFVAVHSLVFATPLIQAPPIQDVSKAHRRQPKRLYEKKGKKGHPGYDRGPKETTVYVHYTLTATKTITIGNDDSRGRDDSGRGREGGPRFDFGQLFEYERLLAAPTPIPDASLLCFQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.09
5 0.09
6 0.09
7 0.06
8 0.06
9 0.07
10 0.08
11 0.08
12 0.09
13 0.09
14 0.13
15 0.14
16 0.14
17 0.14
18 0.16
19 0.23
20 0.33
21 0.35
22 0.39
23 0.46
24 0.51
25 0.59
26 0.66
27 0.69
28 0.7
29 0.76
30 0.79
31 0.81
32 0.87
33 0.87
34 0.87
35 0.8
36 0.8
37 0.78
38 0.77
39 0.73
40 0.69
41 0.64
42 0.65
43 0.62
44 0.55
45 0.49
46 0.4
47 0.35
48 0.3
49 0.26
50 0.19
51 0.2
52 0.17
53 0.16
54 0.16
55 0.14
56 0.13
57 0.13
58 0.11
59 0.09
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.1
66 0.11
67 0.15
68 0.14
69 0.15
70 0.17
71 0.18
72 0.18
73 0.18
74 0.19
75 0.23
76 0.28
77 0.29
78 0.28
79 0.27
80 0.32
81 0.33
82 0.38
83 0.32
84 0.29
85 0.28
86 0.31
87 0.3
88 0.25
89 0.26
90 0.2
91 0.22
92 0.2
93 0.19
94 0.16
95 0.16
96 0.14
97 0.12
98 0.11
99 0.1
100 0.12
101 0.12
102 0.16
103 0.15
104 0.16
105 0.15
106 0.16
107 0.17