Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BRW8

Protein Details
Accession I1BRW8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-44KPSSSSGGKKAKKKWSAKKVKDKANNLVIHydrophilic
NLS Segment(s)
PositionSequence
11-38KDVAAKPSSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MDEMRKNDAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNLVILDKPTYERLFKEVPTYKLISQSVLVDRLKLNGSLARIAIRELESQGLIKPISRHHAQIIYTRATGDEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.48
3 0.44
4 0.43
5 0.41
6 0.36
7 0.32
8 0.32
9 0.39
10 0.45
11 0.5
12 0.56
13 0.63
14 0.7
15 0.78
16 0.81
17 0.81
18 0.86
19 0.88
20 0.91
21 0.89
22 0.9
23 0.88
24 0.84
25 0.8
26 0.76
27 0.68
28 0.58
29 0.52
30 0.42
31 0.35
32 0.29
33 0.22
34 0.16
35 0.16
36 0.17
37 0.15
38 0.14
39 0.16
40 0.17
41 0.17
42 0.24
43 0.25
44 0.26
45 0.28
46 0.3
47 0.27
48 0.29
49 0.29
50 0.22
51 0.18
52 0.19
53 0.17
54 0.19
55 0.18
56 0.15
57 0.15
58 0.16
59 0.16
60 0.14
61 0.14
62 0.11
63 0.13
64 0.13
65 0.13
66 0.13
67 0.12
68 0.12
69 0.13
70 0.13
71 0.13
72 0.12
73 0.13
74 0.12
75 0.13
76 0.13
77 0.14
78 0.12
79 0.13
80 0.14
81 0.17
82 0.23
83 0.25
84 0.27
85 0.29
86 0.34
87 0.34
88 0.39
89 0.41
90 0.38
91 0.36
92 0.34