Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1BKK6

Protein Details
Accession I1BKK6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-34QHTKIHIGNKKSKTRGRKRKQKRPAHESPPTSBasic
NLS Segment(s)
PositionSequence
10-27GNKKSKTRGRKRKQKRPA
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MMQHTKIHIGNKKSKTRGRKRKQKRPAHESPPTSEIDPTMPPVVDGFRAGRVLSIQELCHPSNEEIMASAARCISLSDIQAIGVLVFMSREV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.81
4 0.85
5 0.86
6 0.88
7 0.9
8 0.92
9 0.95
10 0.95
11 0.94
12 0.92
13 0.91
14 0.89
15 0.87
16 0.79
17 0.73
18 0.65
19 0.56
20 0.47
21 0.37
22 0.28
23 0.21
24 0.18
25 0.15
26 0.13
27 0.11
28 0.1
29 0.1
30 0.1
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.07
38 0.07
39 0.08
40 0.08
41 0.09
42 0.08
43 0.11
44 0.15
45 0.15
46 0.16
47 0.18
48 0.17
49 0.17
50 0.17
51 0.14
52 0.11
53 0.11
54 0.11
55 0.09
56 0.09
57 0.07
58 0.07
59 0.07
60 0.07
61 0.09
62 0.11
63 0.11
64 0.13
65 0.13
66 0.13
67 0.13
68 0.13
69 0.1
70 0.07
71 0.06
72 0.04