Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1C6U9

Protein Details
Accession I1C6U9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
13-76YVSETLLKKRKRNDKIAAEKAKERAETKKKQKLAQRTQFKRADEFVRAFRTKEKQKRRISSIEAHydrophilic
NLS Segment(s)
PositionSequence
20-87KKRKRNDKIAAEKAKERAETKKKQKLAQRTQFKRADEFVRAFRTKEKQKRRISSIEAGKNKASKRKQG
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR012988  Ribosomal_L30_N  
IPR039699  Ribosomal_L7/L30  
IPR035808  Ribosomal_L7_euk_arc  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PF08079  Ribosomal_L30_N  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences MSDSHRTIANPVYVSETLLKKRKRNDKIAAEKAKERAETKKKQKLAQRTQFKRADEFVRAFRTKEKQKRRISSIEAGKNKASKRKQGDGRLLFVARIKTDKAIHPDIVRALKNLRLLKMNSGVFVVCNETTMQDLLRVEPFVTYGSPSLKTIRDLIMKRGSTLVSGKRTPLSNNAIIEEALGKLDIICLEDLVHEVSTVGENFASVTSFLEPFELHDPVKGWRQKKLKEVIERSSEEESADDDINKLVETMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.34
5 0.41
6 0.48
7 0.49
8 0.58
9 0.67
10 0.71
11 0.76
12 0.78
13 0.81
14 0.84
15 0.89
16 0.88
17 0.82
18 0.78
19 0.73
20 0.68
21 0.61
22 0.53
23 0.53
24 0.53
25 0.59
26 0.65
27 0.69
28 0.7
29 0.73
30 0.79
31 0.79
32 0.8
33 0.8
34 0.81
35 0.78
36 0.82
37 0.81
38 0.75
39 0.68
40 0.61
41 0.56
42 0.51
43 0.47
44 0.42
45 0.45
46 0.44
47 0.4
48 0.42
49 0.46
50 0.51
51 0.57
52 0.63
53 0.65
54 0.74
55 0.81
56 0.82
57 0.81
58 0.77
59 0.75
60 0.74
61 0.73
62 0.67
63 0.61
64 0.57
65 0.54
66 0.5
67 0.51
68 0.47
69 0.46
70 0.49
71 0.56
72 0.62
73 0.65
74 0.72
75 0.66
76 0.64
77 0.59
78 0.51
79 0.42
80 0.37
81 0.29
82 0.2
83 0.18
84 0.15
85 0.15
86 0.17
87 0.2
88 0.24
89 0.26
90 0.27
91 0.26
92 0.26
93 0.27
94 0.28
95 0.25
96 0.2
97 0.18
98 0.19
99 0.24
100 0.25
101 0.23
102 0.23
103 0.23
104 0.25
105 0.29
106 0.27
107 0.21
108 0.19
109 0.18
110 0.14
111 0.14
112 0.13
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.07
126 0.07
127 0.08
128 0.07
129 0.07
130 0.07
131 0.07
132 0.09
133 0.09
134 0.1
135 0.13
136 0.13
137 0.14
138 0.15
139 0.17
140 0.23
141 0.23
142 0.28
143 0.33
144 0.32
145 0.32
146 0.31
147 0.28
148 0.23
149 0.26
150 0.26
151 0.23
152 0.24
153 0.25
154 0.26
155 0.28
156 0.28
157 0.3
158 0.3
159 0.29
160 0.29
161 0.29
162 0.27
163 0.25
164 0.24
165 0.18
166 0.12
167 0.08
168 0.07
169 0.05
170 0.04
171 0.05
172 0.05
173 0.06
174 0.05
175 0.05
176 0.06
177 0.06
178 0.07
179 0.08
180 0.07
181 0.06
182 0.06
183 0.06
184 0.08
185 0.08
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07
191 0.07
192 0.06
193 0.07
194 0.08
195 0.08
196 0.09
197 0.09
198 0.09
199 0.12
200 0.15
201 0.16
202 0.15
203 0.16
204 0.17
205 0.2
206 0.29
207 0.33
208 0.32
209 0.39
210 0.48
211 0.53
212 0.61
213 0.67
214 0.67
215 0.71
216 0.76
217 0.75
218 0.74
219 0.7
220 0.65
221 0.59
222 0.5
223 0.4
224 0.33
225 0.26
226 0.21
227 0.2
228 0.16
229 0.13
230 0.14
231 0.13
232 0.13