Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1C2F3

Protein Details
Accession I1C2F3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-31HCTFPDNKTNRNKHNQGRTHVHydrophilic
98-117LTTPKPTRPIQQKRHCLPFGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000690  Matrin/U1-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR036236  Znf_C2H2_sf  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF06220  zf-U1  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
PS50171  ZF_MATRIN  
Amino Acid Sequences MPKNYYCDFCHCTFPDNKTNRNKHNQGRTHVHNRKLHYDWFNDQEGFIRNQVNKLPCKYYMNHGYCEYGLLCKYSHIKSDPLTGQLIYPKEILYFQSLTTPKPTRPIQQKRHCLPFGWKLKDLPPSLKPPPSSNHRWEYVNQWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.51
4 0.58
5 0.6
6 0.69
7 0.72
8 0.76
9 0.79
10 0.79
11 0.83
12 0.82
13 0.79
14 0.79
15 0.78
16 0.79
17 0.77
18 0.77
19 0.71
20 0.68
21 0.67
22 0.62
23 0.61
24 0.54
25 0.51
26 0.47
27 0.46
28 0.45
29 0.37
30 0.34
31 0.29
32 0.27
33 0.24
34 0.21
35 0.21
36 0.18
37 0.2
38 0.25
39 0.27
40 0.28
41 0.29
42 0.31
43 0.29
44 0.32
45 0.32
46 0.34
47 0.39
48 0.37
49 0.37
50 0.35
51 0.33
52 0.3
53 0.3
54 0.22
55 0.13
56 0.11
57 0.09
58 0.08
59 0.09
60 0.12
61 0.12
62 0.15
63 0.15
64 0.17
65 0.17
66 0.23
67 0.23
68 0.21
69 0.21
70 0.18
71 0.17
72 0.19
73 0.19
74 0.14
75 0.14
76 0.12
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.11
83 0.18
84 0.19
85 0.19
86 0.26
87 0.27
88 0.25
89 0.31
90 0.34
91 0.36
92 0.46
93 0.56
94 0.6
95 0.68
96 0.78
97 0.78
98 0.84
99 0.77
100 0.69
101 0.65
102 0.65
103 0.64
104 0.6
105 0.56
106 0.49
107 0.52
108 0.57
109 0.53
110 0.49
111 0.45
112 0.47
113 0.5
114 0.54
115 0.52
116 0.49
117 0.53
118 0.55
119 0.58
120 0.58
121 0.58
122 0.56
123 0.56
124 0.54