Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1CES6

Protein Details
Accession I1CES6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-38EDRKRNKSTSLLKRRNKQLTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001849  PH_domain  
PROSITE View protein in PROSITE  
PS50003  PH_DOMAIN  
Amino Acid Sequences MIRCESESDVKLWIRAIEDRKRNKSTSLLKRRNKQLTPIIIITQQQSNYSLITPSLSTSSSSLILSPPNLNTRVPPCAIDNNKEGNNLIIEEDELSPTYLIYKKRFRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.31
4 0.35
5 0.44
6 0.52
7 0.6
8 0.64
9 0.63
10 0.6
11 0.61
12 0.63
13 0.65
14 0.66
15 0.68
16 0.71
17 0.78
18 0.85
19 0.85
20 0.77
21 0.73
22 0.7
23 0.65
24 0.62
25 0.54
26 0.46
27 0.38
28 0.36
29 0.3
30 0.24
31 0.19
32 0.14
33 0.14
34 0.13
35 0.12
36 0.12
37 0.1
38 0.08
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.09
52 0.1
53 0.1
54 0.11
55 0.13
56 0.15
57 0.15
58 0.17
59 0.2
60 0.22
61 0.22
62 0.21
63 0.21
64 0.29
65 0.32
66 0.33
67 0.34
68 0.36
69 0.36
70 0.36
71 0.33
72 0.26
73 0.23
74 0.2
75 0.16
76 0.11
77 0.1
78 0.11
79 0.11
80 0.1
81 0.1
82 0.1
83 0.1
84 0.09
85 0.12
86 0.15
87 0.2
88 0.27