Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BWV2

Protein Details
Accession I1BWV2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-105TKVKLGKAKKQNRPLPHWFRLKSDTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
66-99KLGKAKKQNRPLPHWFRLKSDTKIRWNAKRRNWR
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MTAKEIGKISDLGHVKEALPLELESLIQMVCENIESVIAPSLFFGKQIIHVLAHNPSQKSFITKVKLGKAKKQNRPLPHWFRLKSDTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.23
4 0.23
5 0.16
6 0.15
7 0.13
8 0.12
9 0.11
10 0.11
11 0.08
12 0.08
13 0.07
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.07
25 0.07
26 0.06
27 0.06
28 0.08
29 0.08
30 0.08
31 0.08
32 0.06
33 0.08
34 0.1
35 0.1
36 0.09
37 0.09
38 0.1
39 0.12
40 0.15
41 0.17
42 0.15
43 0.15
44 0.17
45 0.17
46 0.2
47 0.21
48 0.23
49 0.24
50 0.28
51 0.32
52 0.37
53 0.44
54 0.43
55 0.49
56 0.54
57 0.61
58 0.66
59 0.72
60 0.73
61 0.73
62 0.79
63 0.8
64 0.79
65 0.77
66 0.77
67 0.69
68 0.66
69 0.66
70 0.64
71 0.61
72 0.62
73 0.62
74 0.61
75 0.69
76 0.72
77 0.75
78 0.79
79 0.82
80 0.82
81 0.85
82 0.84
83 0.85
84 0.88
85 0.86