Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1BNP7

Protein Details
Accession I1BNP7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-70NDTSRKVKRVKAAIKKRRAARGKBasic
NLS Segment(s)
PositionSequence
52-70RKVKRVKAAIKKRRAARGK
Subcellular Location(s) extr 10, E.R. 6, plas 4, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MKACLVLLTALLFNVMLVFAVKESSIVGIVDPRVADHKGLDPDVLDPNDTSRKVKRVKAAIKKRRAARGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.06
19 0.06
20 0.08
21 0.08
22 0.08
23 0.08
24 0.11
25 0.12
26 0.13
27 0.13
28 0.11
29 0.12
30 0.16
31 0.15
32 0.12
33 0.11
34 0.14
35 0.19
36 0.2
37 0.22
38 0.23
39 0.31
40 0.36
41 0.42
42 0.47
43 0.53
44 0.62
45 0.7
46 0.77
47 0.79
48 0.83
49 0.86
50 0.86