Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7THW1

Protein Details
Accession A7THW1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
302-321SVEMRKQRNKSTKQVRTIEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 8.5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037231  NAP-like_sf  
IPR002164  NAP_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0006334  P:nucleosome assembly  
KEGG vpo:Kpol_1031p27  -  
Pfam View protein in Pfam  
PF00956  NAP  
Amino Acid Sequences MTDPIKVNKPKSSMKIENAPTPHNTPAGNMEFFKNGNPMKGNKSNNSNADSNDDSSNDSKPQTINEEDIKTVLSNQPLLLQSIQEKLGSLIGQDSGYVENLPKVVKNRIYALKSLQTDLFQIEKDFQVEMFELEQKYLTKYAPVHLHRKQLIVGEIEPTEEEINKGKELEDLERGEDEEAEDEEEEAEEEEEEDEGEYEGVPSFWLTALENLPVVSDTITDRDAEVLEYLTDVKLEYCTSGKPGFKLIFEFDDKENPFFTNKELVKTYYYQSELGYSGDFIYDHAEGNEIKWVDNESNVTVSVEMRKQRNKSTKQVRTIEKITPIESFFNFFDPPKIDETHQHSAECEGGEEEEEEEYEDLEQRLALDYSIGEQIKDKLIPRAVDWFTGSALEFEYDNGEEEEFEDEEDYDEDEEEEGEEEEDDDFAGKKEEAPECKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.69
4 0.7
5 0.66
6 0.62
7 0.57
8 0.52
9 0.48
10 0.41
11 0.36
12 0.3
13 0.34
14 0.35
15 0.33
16 0.3
17 0.29
18 0.29
19 0.29
20 0.29
21 0.29
22 0.25
23 0.28
24 0.31
25 0.33
26 0.39
27 0.47
28 0.52
29 0.52
30 0.59
31 0.61
32 0.62
33 0.64
34 0.57
35 0.5
36 0.49
37 0.45
38 0.4
39 0.34
40 0.29
41 0.27
42 0.26
43 0.27
44 0.24
45 0.21
46 0.21
47 0.21
48 0.23
49 0.26
50 0.27
51 0.29
52 0.32
53 0.33
54 0.31
55 0.3
56 0.28
57 0.22
58 0.22
59 0.21
60 0.17
61 0.16
62 0.16
63 0.2
64 0.2
65 0.22
66 0.19
67 0.18
68 0.17
69 0.19
70 0.2
71 0.15
72 0.15
73 0.13
74 0.15
75 0.13
76 0.11
77 0.09
78 0.1
79 0.09
80 0.09
81 0.09
82 0.08
83 0.09
84 0.09
85 0.08
86 0.08
87 0.1
88 0.1
89 0.12
90 0.15
91 0.22
92 0.25
93 0.27
94 0.33
95 0.4
96 0.42
97 0.41
98 0.42
99 0.42
100 0.39
101 0.39
102 0.34
103 0.27
104 0.25
105 0.25
106 0.21
107 0.15
108 0.14
109 0.14
110 0.13
111 0.14
112 0.13
113 0.11
114 0.11
115 0.1
116 0.11
117 0.1
118 0.13
119 0.12
120 0.12
121 0.13
122 0.12
123 0.14
124 0.15
125 0.13
126 0.14
127 0.15
128 0.19
129 0.27
130 0.32
131 0.39
132 0.42
133 0.5
134 0.48
135 0.48
136 0.44
137 0.38
138 0.36
139 0.3
140 0.25
141 0.19
142 0.17
143 0.16
144 0.14
145 0.13
146 0.1
147 0.08
148 0.09
149 0.1
150 0.11
151 0.11
152 0.12
153 0.11
154 0.13
155 0.15
156 0.16
157 0.17
158 0.17
159 0.17
160 0.17
161 0.17
162 0.15
163 0.13
164 0.11
165 0.07
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.06
195 0.06
196 0.07
197 0.07
198 0.07
199 0.06
200 0.06
201 0.06
202 0.04
203 0.04
204 0.04
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.07
211 0.06
212 0.06
213 0.05
214 0.04
215 0.05
216 0.05
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.05
223 0.06
224 0.06
225 0.06
226 0.1
227 0.14
228 0.14
229 0.14
230 0.19
231 0.19
232 0.19
233 0.2
234 0.19
235 0.18
236 0.19
237 0.21
238 0.17
239 0.23
240 0.23
241 0.22
242 0.21
243 0.19
244 0.18
245 0.16
246 0.18
247 0.19
248 0.19
249 0.22
250 0.22
251 0.23
252 0.25
253 0.26
254 0.26
255 0.21
256 0.22
257 0.2
258 0.18
259 0.18
260 0.16
261 0.15
262 0.13
263 0.1
264 0.08
265 0.08
266 0.07
267 0.06
268 0.07
269 0.07
270 0.07
271 0.07
272 0.08
273 0.08
274 0.09
275 0.12
276 0.1
277 0.1
278 0.1
279 0.12
280 0.11
281 0.13
282 0.14
283 0.11
284 0.11
285 0.11
286 0.11
287 0.1
288 0.1
289 0.12
290 0.15
291 0.2
292 0.25
293 0.32
294 0.36
295 0.45
296 0.54
297 0.58
298 0.64
299 0.7
300 0.73
301 0.76
302 0.81
303 0.77
304 0.74
305 0.71
306 0.65
307 0.61
308 0.54
309 0.46
310 0.4
311 0.35
312 0.31
313 0.27
314 0.26
315 0.19
316 0.2
317 0.19
318 0.17
319 0.19
320 0.19
321 0.21
322 0.21
323 0.23
324 0.22
325 0.28
326 0.36
327 0.41
328 0.4
329 0.38
330 0.35
331 0.34
332 0.34
333 0.27
334 0.2
335 0.12
336 0.1
337 0.1
338 0.1
339 0.1
340 0.08
341 0.08
342 0.08
343 0.07
344 0.07
345 0.07
346 0.09
347 0.08
348 0.08
349 0.08
350 0.08
351 0.1
352 0.1
353 0.09
354 0.08
355 0.07
356 0.09
357 0.15
358 0.14
359 0.13
360 0.14
361 0.16
362 0.19
363 0.22
364 0.22
365 0.23
366 0.28
367 0.29
368 0.29
369 0.36
370 0.34
371 0.33
372 0.33
373 0.27
374 0.23
375 0.23
376 0.21
377 0.13
378 0.13
379 0.11
380 0.1
381 0.09
382 0.11
383 0.1
384 0.12
385 0.12
386 0.11
387 0.1
388 0.11
389 0.13
390 0.11
391 0.11
392 0.1
393 0.1
394 0.11
395 0.11
396 0.11
397 0.09
398 0.09
399 0.1
400 0.09
401 0.09
402 0.08
403 0.08
404 0.08
405 0.08
406 0.08
407 0.08
408 0.08
409 0.08
410 0.07
411 0.07
412 0.07
413 0.08
414 0.1
415 0.1
416 0.13
417 0.2
418 0.27
419 0.33