Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5A6S0

Protein Details
Accession Q5A6S0   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-35NKYPENLRKHFQKNKEITNLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito_nucl 12.499, cyto_nucl 12.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
KEGG cal:CAALFM_CR04010CA  -  
Amino Acid Sequences MSWVTRTFRFERNVNKYPENLRKHFQKNKEITNLPSFKNFFPTTLPRSQQKTNVEAGIMEGDLAYVTTGSHKGKIAEVLSYSPEYDAVSLSNISSKKLIPKIFWPEGQTSHVFDFPDYIPRNQVRVVGKDKDENGNVSYVVAEDIELRDKYYDDRFKKFMPRRFVKYHENIEFPWPEPQALEDGPLSTPENVAMERTFEFNSIAKSGIPKAALAQLRNPYSKHKKKTLSGLQVAKLNGPEMPLTIEQKIWIAKNQEKQAETKPEYKPLSDEVQEFIGKKMAEHLNKIESPELRYHLDVLSNSVSHDFQKTLDIIEKTKSQGDSELTNSTGESSDKGSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.64
4 0.67
5 0.7
6 0.69
7 0.64
8 0.64
9 0.67
10 0.73
11 0.77
12 0.77
13 0.77
14 0.77
15 0.81
16 0.82
17 0.77
18 0.72
19 0.73
20 0.69
21 0.6
22 0.59
23 0.53
24 0.45
25 0.48
26 0.43
27 0.34
28 0.35
29 0.4
30 0.4
31 0.45
32 0.49
33 0.48
34 0.53
35 0.57
36 0.58
37 0.57
38 0.54
39 0.5
40 0.46
41 0.4
42 0.34
43 0.3
44 0.23
45 0.17
46 0.12
47 0.08
48 0.06
49 0.05
50 0.05
51 0.04
52 0.03
53 0.03
54 0.05
55 0.09
56 0.11
57 0.13
58 0.15
59 0.16
60 0.18
61 0.22
62 0.21
63 0.19
64 0.19
65 0.18
66 0.19
67 0.19
68 0.17
69 0.13
70 0.13
71 0.11
72 0.1
73 0.09
74 0.07
75 0.07
76 0.07
77 0.07
78 0.12
79 0.12
80 0.12
81 0.13
82 0.14
83 0.2
84 0.27
85 0.29
86 0.26
87 0.34
88 0.42
89 0.44
90 0.45
91 0.42
92 0.38
93 0.38
94 0.4
95 0.34
96 0.27
97 0.24
98 0.24
99 0.2
100 0.17
101 0.18
102 0.15
103 0.22
104 0.22
105 0.21
106 0.25
107 0.26
108 0.28
109 0.26
110 0.31
111 0.26
112 0.29
113 0.34
114 0.33
115 0.33
116 0.35
117 0.36
118 0.35
119 0.32
120 0.29
121 0.24
122 0.2
123 0.18
124 0.15
125 0.12
126 0.08
127 0.07
128 0.05
129 0.05
130 0.04
131 0.05
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.11
138 0.17
139 0.26
140 0.27
141 0.31
142 0.33
143 0.36
144 0.46
145 0.51
146 0.51
147 0.53
148 0.55
149 0.58
150 0.61
151 0.64
152 0.62
153 0.6
154 0.61
155 0.54
156 0.49
157 0.43
158 0.41
159 0.37
160 0.29
161 0.27
162 0.19
163 0.16
164 0.14
165 0.14
166 0.12
167 0.11
168 0.11
169 0.08
170 0.08
171 0.08
172 0.1
173 0.1
174 0.08
175 0.08
176 0.07
177 0.07
178 0.07
179 0.08
180 0.07
181 0.07
182 0.08
183 0.1
184 0.1
185 0.1
186 0.11
187 0.11
188 0.12
189 0.11
190 0.11
191 0.1
192 0.11
193 0.12
194 0.13
195 0.12
196 0.11
197 0.11
198 0.17
199 0.19
200 0.18
201 0.22
202 0.25
203 0.29
204 0.31
205 0.31
206 0.34
207 0.43
208 0.51
209 0.54
210 0.57
211 0.61
212 0.64
213 0.74
214 0.74
215 0.72
216 0.71
217 0.68
218 0.62
219 0.59
220 0.54
221 0.45
222 0.35
223 0.26
224 0.19
225 0.15
226 0.12
227 0.08
228 0.11
229 0.12
230 0.14
231 0.14
232 0.14
233 0.13
234 0.15
235 0.18
236 0.16
237 0.18
238 0.22
239 0.27
240 0.35
241 0.41
242 0.44
243 0.43
244 0.45
245 0.49
246 0.53
247 0.51
248 0.52
249 0.48
250 0.52
251 0.52
252 0.49
253 0.44
254 0.38
255 0.39
256 0.34
257 0.32
258 0.25
259 0.27
260 0.27
261 0.26
262 0.23
263 0.21
264 0.18
265 0.17
266 0.23
267 0.28
268 0.29
269 0.32
270 0.35
271 0.38
272 0.39
273 0.41
274 0.39
275 0.33
276 0.33
277 0.34
278 0.33
279 0.3
280 0.29
281 0.29
282 0.25
283 0.27
284 0.24
285 0.23
286 0.22
287 0.2
288 0.2
289 0.2
290 0.19
291 0.17
292 0.2
293 0.16
294 0.14
295 0.18
296 0.18
297 0.18
298 0.24
299 0.25
300 0.25
301 0.28
302 0.31
303 0.29
304 0.34
305 0.33
306 0.27
307 0.3
308 0.31
309 0.31
310 0.31
311 0.32
312 0.27
313 0.26
314 0.25
315 0.21
316 0.2
317 0.17
318 0.14