Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7E1T7

Protein Details
Accession G7E1T7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-33AQNAGKAAKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
11-27GKAAKKKKWSKGKVKDK
Subcellular Location(s) mito 12, mito_nucl 10.999, nucl 7.5, cyto_nucl 7.166, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAAGAQNAGKAAKKKKWSKGKVKDKANNAVVLDKPTYDKILKEVPTFKMISQLIVVWSVCLDRPNEDQRVPSTTSHSTLGQGGCHQTHRSPPWSTDLQSARAFQQVYTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.49
3 0.57
4 0.63
5 0.72
6 0.79
7 0.83
8 0.87
9 0.9
10 0.9
11 0.91
12 0.89
13 0.85
14 0.84
15 0.75
16 0.68
17 0.57
18 0.51
19 0.41
20 0.37
21 0.29
22 0.2
23 0.19
24 0.16
25 0.19
26 0.16
27 0.15
28 0.15
29 0.21
30 0.23
31 0.24
32 0.27
33 0.26
34 0.28
35 0.29
36 0.26
37 0.26
38 0.23
39 0.21
40 0.17
41 0.16
42 0.13
43 0.13
44 0.13
45 0.06
46 0.06
47 0.05
48 0.06
49 0.07
50 0.07
51 0.09
52 0.14
53 0.18
54 0.22
55 0.22
56 0.24
57 0.24
58 0.28
59 0.28
60 0.24
61 0.24
62 0.23
63 0.25
64 0.25
65 0.23
66 0.2
67 0.21
68 0.21
69 0.17
70 0.17
71 0.18
72 0.17
73 0.2
74 0.2
75 0.19
76 0.26
77 0.31
78 0.35
79 0.35
80 0.36
81 0.39
82 0.42
83 0.42
84 0.42
85 0.41
86 0.41
87 0.4
88 0.4
89 0.35
90 0.35
91 0.34