Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7DYK6

Protein Details
Accession G7DYK6   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-41ANPRQRSKARSGATKNRPSKRSLAKIKKNKTKTVFKGPGVHydrophilic
NLS Segment(s)
PositionSequence
5-34RQRSKARSGATKNRPSKRSLAKIKKNKTKT
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRSKARSGATKNRPSKRSLAKIKKNKTKTVFKGPGVLEPLWDRKKTTRQNYIGMGLLTTLNPKQSGGLERIEGIPFALRARQANAQANAHASTSTTTSSDDEAELDMDASAAPASRKGKEKESDKIPKGFARVERDADGNITKVTLADEDAESADEPGSTPWGAPLDVWQTDVAAPAEPSPAELEPDGVLDHTRDQSQGLPLSLSAARASLRSQDPKLLPTAQNRDATQAQARKAVAALEDLAAGATSVDRHTSSNEQDWLAELVKRYGSDIAAMARDKKLNTWQRTPGEIKRRLRKAGLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.85
4 0.84
5 0.81
6 0.75
7 0.75
8 0.75
9 0.75
10 0.75
11 0.77
12 0.78
13 0.86
14 0.92
15 0.93
16 0.9
17 0.89
18 0.87
19 0.87
20 0.84
21 0.84
22 0.82
23 0.73
24 0.74
25 0.65
26 0.62
27 0.56
28 0.47
29 0.38
30 0.34
31 0.41
32 0.38
33 0.38
34 0.35
35 0.38
36 0.48
37 0.56
38 0.62
39 0.63
40 0.63
41 0.68
42 0.69
43 0.64
44 0.56
45 0.46
46 0.36
47 0.26
48 0.21
49 0.15
50 0.14
51 0.12
52 0.11
53 0.11
54 0.11
55 0.12
56 0.14
57 0.17
58 0.18
59 0.19
60 0.18
61 0.19
62 0.21
63 0.19
64 0.16
65 0.13
66 0.11
67 0.09
68 0.1
69 0.1
70 0.1
71 0.11
72 0.15
73 0.19
74 0.23
75 0.3
76 0.32
77 0.31
78 0.3
79 0.31
80 0.29
81 0.25
82 0.19
83 0.13
84 0.1
85 0.1
86 0.1
87 0.09
88 0.09
89 0.1
90 0.11
91 0.11
92 0.1
93 0.1
94 0.09
95 0.09
96 0.08
97 0.07
98 0.06
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.08
106 0.1
107 0.13
108 0.2
109 0.22
110 0.29
111 0.36
112 0.41
113 0.44
114 0.52
115 0.58
116 0.56
117 0.57
118 0.52
119 0.47
120 0.45
121 0.42
122 0.37
123 0.35
124 0.34
125 0.32
126 0.31
127 0.29
128 0.27
129 0.24
130 0.2
131 0.13
132 0.1
133 0.08
134 0.07
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.05
147 0.04
148 0.04
149 0.04
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.08
158 0.1
159 0.1
160 0.11
161 0.1
162 0.1
163 0.1
164 0.11
165 0.09
166 0.07
167 0.07
168 0.06
169 0.07
170 0.06
171 0.07
172 0.07
173 0.07
174 0.08
175 0.07
176 0.08
177 0.07
178 0.08
179 0.07
180 0.06
181 0.06
182 0.06
183 0.08
184 0.08
185 0.09
186 0.09
187 0.09
188 0.11
189 0.14
190 0.15
191 0.13
192 0.12
193 0.12
194 0.14
195 0.14
196 0.12
197 0.09
198 0.09
199 0.09
200 0.09
201 0.1
202 0.13
203 0.18
204 0.22
205 0.23
206 0.29
207 0.3
208 0.31
209 0.34
210 0.34
211 0.33
212 0.36
213 0.43
214 0.42
215 0.45
216 0.44
217 0.45
218 0.41
219 0.4
220 0.39
221 0.36
222 0.32
223 0.33
224 0.32
225 0.28
226 0.27
227 0.25
228 0.18
229 0.14
230 0.14
231 0.09
232 0.09
233 0.08
234 0.08
235 0.06
236 0.06
237 0.04
238 0.04
239 0.04
240 0.05
241 0.06
242 0.08
243 0.09
244 0.13
245 0.18
246 0.22
247 0.27
248 0.3
249 0.29
250 0.28
251 0.29
252 0.27
253 0.24
254 0.21
255 0.17
256 0.16
257 0.17
258 0.17
259 0.17
260 0.17
261 0.15
262 0.15
263 0.15
264 0.15
265 0.18
266 0.19
267 0.21
268 0.22
269 0.25
270 0.25
271 0.27
272 0.35
273 0.41
274 0.47
275 0.53
276 0.58
277 0.6
278 0.67
279 0.69
280 0.69
281 0.69
282 0.71
283 0.73
284 0.74
285 0.78
286 0.77
287 0.75