Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59TS6

Protein Details
Accession Q59TS6   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-76ATTKKIAKPKRDETQIKRRTKTGCLTCRKRKKKCDEDKVNGKCQAHydrophilic
NLS Segment(s)
PositionSequence
35-43KKIAKPKRD
Subcellular Location(s) nucl 19, cyto_nucl 13, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
GO:0030447  P:filamentous growth  
GO:0070783  P:growth of unicellular organism as a thread of attached cells  
GO:0070784  P:regulation of growth of unicellular organism as a thread of attached cells  
KEGG cal:CAALFM_C111520CA  -  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MELSYRSYQKVLNISLKPKTTHACSKKATAAATTKKIAKPKRDETQIKRRTKTGCLTCRKRKKKCDEDKVNGKCQACTRNFLDCCWPDPNTIKTKNTKPQQQAQQSTEVKPQISPVVRPKKCDINYLLHSQPEPSTPVATVVATQPKVHIPYPSPTLSPVFTESKPNSEVSSFALPPIYSPNYKLQTKDSNVRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.54
4 0.51
5 0.49
6 0.48
7 0.46
8 0.51
9 0.52
10 0.54
11 0.54
12 0.58
13 0.59
14 0.57
15 0.51
16 0.45
17 0.47
18 0.46
19 0.47
20 0.46
21 0.46
22 0.46
23 0.54
24 0.56
25 0.57
26 0.59
27 0.63
28 0.69
29 0.73
30 0.79
31 0.79
32 0.83
33 0.83
34 0.83
35 0.77
36 0.73
37 0.67
38 0.63
39 0.64
40 0.63
41 0.62
42 0.64
43 0.71
44 0.77
45 0.84
46 0.88
47 0.88
48 0.89
49 0.9
50 0.9
51 0.91
52 0.92
53 0.91
54 0.91
55 0.91
56 0.87
57 0.83
58 0.77
59 0.66
60 0.57
61 0.51
62 0.49
63 0.4
64 0.39
65 0.34
66 0.38
67 0.38
68 0.36
69 0.39
70 0.32
71 0.34
72 0.31
73 0.3
74 0.23
75 0.26
76 0.3
77 0.29
78 0.33
79 0.33
80 0.36
81 0.42
82 0.49
83 0.52
84 0.55
85 0.53
86 0.57
87 0.62
88 0.65
89 0.64
90 0.57
91 0.6
92 0.53
93 0.51
94 0.47
95 0.39
96 0.31
97 0.25
98 0.24
99 0.21
100 0.2
101 0.22
102 0.27
103 0.37
104 0.38
105 0.41
106 0.44
107 0.48
108 0.48
109 0.5
110 0.44
111 0.41
112 0.44
113 0.46
114 0.44
115 0.35
116 0.34
117 0.29
118 0.26
119 0.2
120 0.18
121 0.14
122 0.13
123 0.12
124 0.13
125 0.13
126 0.12
127 0.11
128 0.12
129 0.17
130 0.17
131 0.17
132 0.17
133 0.19
134 0.23
135 0.23
136 0.23
137 0.2
138 0.24
139 0.3
140 0.3
141 0.28
142 0.26
143 0.27
144 0.25
145 0.24
146 0.24
147 0.23
148 0.22
149 0.3
150 0.29
151 0.32
152 0.33
153 0.31
154 0.29
155 0.25
156 0.25
157 0.22
158 0.26
159 0.22
160 0.21
161 0.22
162 0.2
163 0.2
164 0.25
165 0.26
166 0.21
167 0.24
168 0.32
169 0.37
170 0.4
171 0.42
172 0.43
173 0.48
174 0.54
175 0.6