Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7DX05

Protein Details
Accession G7DX05    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSDRQRDRRSHDDRERRAPLPBasic
39-112RSRHDDDRSRRQRDDRRSPPAQERDSRRSRHRSRSPVPRRSRSPPARRRSRSPVTRKSRSPPARERRRRVEEGRBasic
NLS Segment(s)
PositionSequence
16-30RRAPLPPSHGRERPR
46-144RSRRQRDDRRSPPAQERDSRRSRHRSRSPVPRRSRSPPARRRSRSPVTRKSRSPPARERRRRVEEGRRSPAGSHRRSPPPPRARSPVPARERAKDEPHR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSDRQRDRRSHDDRERRAPLPPSHGRERPRSDSRYDNDRSRHDDDRSRRQRDDRRSPPAQERDSRRSRHRSRSPVPRRSRSPPARRRSRSPVTRKSRSPPARERRRRVEEGRRSPAGSHRRSPPPPRARSPVPARERAKDEPHRAVRIELTPGSKPAESATPEPARHANKGHVAQEEDEQMEAQDDDDDDAAAMAALMGFGGFGTTKGHHVAGNNDIGTADVKKERVYRQYMNRRGGFNRPLDKMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.73
4 0.72
5 0.69
6 0.64
7 0.63
8 0.64
9 0.61
10 0.63
11 0.68
12 0.67
13 0.68
14 0.71
15 0.7
16 0.7
17 0.67
18 0.64
19 0.66
20 0.66
21 0.66
22 0.63
23 0.62
24 0.59
25 0.61
26 0.63
27 0.6
28 0.6
29 0.57
30 0.6
31 0.61
32 0.66
33 0.7
34 0.69
35 0.7
36 0.73
37 0.77
38 0.78
39 0.81
40 0.79
41 0.78
42 0.77
43 0.77
44 0.77
45 0.77
46 0.73
47 0.7
48 0.69
49 0.69
50 0.71
51 0.72
52 0.71
53 0.73
54 0.75
55 0.77
56 0.79
57 0.8
58 0.8
59 0.85
60 0.87
61 0.86
62 0.87
63 0.85
64 0.82
65 0.79
66 0.81
67 0.8
68 0.81
69 0.8
70 0.81
71 0.83
72 0.82
73 0.83
74 0.81
75 0.81
76 0.8
77 0.8
78 0.8
79 0.79
80 0.81
81 0.78
82 0.74
83 0.75
84 0.73
85 0.71
86 0.71
87 0.73
88 0.77
89 0.82
90 0.84
91 0.83
92 0.83
93 0.81
94 0.79
95 0.79
96 0.78
97 0.78
98 0.76
99 0.67
100 0.6
101 0.53
102 0.53
103 0.51
104 0.45
105 0.4
106 0.4
107 0.46
108 0.51
109 0.56
110 0.59
111 0.59
112 0.61
113 0.62
114 0.62
115 0.57
116 0.6
117 0.62
118 0.61
119 0.56
120 0.59
121 0.57
122 0.54
123 0.56
124 0.53
125 0.54
126 0.52
127 0.53
128 0.53
129 0.55
130 0.53
131 0.48
132 0.45
133 0.38
134 0.32
135 0.29
136 0.22
137 0.2
138 0.18
139 0.19
140 0.2
141 0.17
142 0.16
143 0.14
144 0.16
145 0.16
146 0.17
147 0.23
148 0.26
149 0.26
150 0.28
151 0.33
152 0.32
153 0.32
154 0.32
155 0.29
156 0.32
157 0.35
158 0.36
159 0.33
160 0.32
161 0.3
162 0.3
163 0.28
164 0.21
165 0.18
166 0.14
167 0.12
168 0.11
169 0.09
170 0.07
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.04
180 0.03
181 0.03
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.03
190 0.03
191 0.06
192 0.07
193 0.09
194 0.11
195 0.13
196 0.14
197 0.16
198 0.19
199 0.21
200 0.25
201 0.23
202 0.21
203 0.2
204 0.19
205 0.19
206 0.17
207 0.16
208 0.14
209 0.15
210 0.19
211 0.25
212 0.31
213 0.38
214 0.45
215 0.5
216 0.58
217 0.68
218 0.74
219 0.77
220 0.75
221 0.73
222 0.69
223 0.7
224 0.66
225 0.64
226 0.63