Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7E480

Protein Details
Accession G7E480   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
114-140EEAKLAKNRAKRQKKKQRAAKPASTQAHydrophilic
NLS Segment(s)
PositionSequence
117-135KLAKNRAKRQKKKQRAAKP
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSASPVPASKAPAKSRTAVDLQRAQLDRLLANPAKPVVIPERPANGGLKVLRPPQETIKNVQGSSAGAGSGEFHVYKQSRRREYERLKIMEEEDKRDKVVQEAEQRHAERQALEEAKLAKNRAKRQKKKQRAAKPASTQAADSTNGSKAADDVPFKKRKIVASDGAGFAFRSARDDESDDGGPSLPDAPEQTEEAAVEEAPPAIAPETGISIVDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.5
4 0.5
5 0.47
6 0.47
7 0.47
8 0.46
9 0.49
10 0.48
11 0.43
12 0.38
13 0.35
14 0.28
15 0.23
16 0.28
17 0.22
18 0.21
19 0.23
20 0.21
21 0.2
22 0.19
23 0.21
24 0.2
25 0.23
26 0.25
27 0.26
28 0.3
29 0.3
30 0.32
31 0.3
32 0.24
33 0.24
34 0.23
35 0.23
36 0.23
37 0.27
38 0.3
39 0.31
40 0.33
41 0.37
42 0.44
43 0.43
44 0.44
45 0.47
46 0.45
47 0.43
48 0.4
49 0.33
50 0.25
51 0.23
52 0.18
53 0.1
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.12
62 0.13
63 0.19
64 0.26
65 0.34
66 0.4
67 0.46
68 0.52
69 0.58
70 0.65
71 0.69
72 0.7
73 0.63
74 0.58
75 0.53
76 0.49
77 0.46
78 0.39
79 0.35
80 0.31
81 0.29
82 0.28
83 0.28
84 0.26
85 0.21
86 0.23
87 0.22
88 0.27
89 0.29
90 0.32
91 0.36
92 0.36
93 0.35
94 0.32
95 0.27
96 0.19
97 0.17
98 0.2
99 0.16
100 0.15
101 0.17
102 0.18
103 0.19
104 0.21
105 0.21
106 0.19
107 0.25
108 0.34
109 0.43
110 0.52
111 0.59
112 0.69
113 0.79
114 0.87
115 0.9
116 0.92
117 0.91
118 0.91
119 0.89
120 0.87
121 0.82
122 0.79
123 0.71
124 0.62
125 0.51
126 0.42
127 0.36
128 0.27
129 0.22
130 0.16
131 0.14
132 0.14
133 0.13
134 0.12
135 0.1
136 0.11
137 0.13
138 0.15
139 0.17
140 0.25
141 0.32
142 0.33
143 0.37
144 0.38
145 0.4
146 0.44
147 0.46
148 0.43
149 0.43
150 0.45
151 0.41
152 0.38
153 0.33
154 0.27
155 0.21
156 0.16
157 0.11
158 0.1
159 0.11
160 0.13
161 0.15
162 0.18
163 0.19
164 0.22
165 0.23
166 0.2
167 0.19
168 0.18
169 0.15
170 0.13
171 0.13
172 0.09
173 0.08
174 0.09
175 0.11
176 0.13
177 0.15
178 0.15
179 0.14
180 0.14
181 0.15
182 0.14
183 0.11
184 0.1
185 0.09
186 0.08
187 0.07
188 0.07
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.09
195 0.1
196 0.1
197 0.1