Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S1H3

Protein Details
Accession E3S1H3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-65GSSKHPKSRRPLAAPKVQKRPHNBasic
NLS Segment(s)
PositionSequence
43-64GSSKHPKSRRPLAAPKVQKRPH
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
KEGG pte:PTT_16063  -  
Amino Acid Sequences MSQAMPSIETYIAYALHIVANFRWKRTSTKVQKAHLSTRSPEGSSKHPKSRRPLAAPKVQKRPHNVDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.08
5 0.08
6 0.08
7 0.17
8 0.18
9 0.19
10 0.22
11 0.22
12 0.27
13 0.34
14 0.44
15 0.45
16 0.55
17 0.61
18 0.63
19 0.67
20 0.66
21 0.65
22 0.6
23 0.53
24 0.44
25 0.42
26 0.39
27 0.34
28 0.32
29 0.29
30 0.31
31 0.39
32 0.44
33 0.49
34 0.54
35 0.59
36 0.65
37 0.73
38 0.74
39 0.73
40 0.76
41 0.75
42 0.78
43 0.82
44 0.83
45 0.83
46 0.81
47 0.78
48 0.77