Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7E845

Protein Details
Accession G7E845   
Localization Confidence High
Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-28VAQIAFKKRSRPAQTIKRPSQSDGHydrophilic
287-307DEEVLERYRKRQRQLQQQHKRHydrophilic
NLS Segment(s)
PositionSequence
77-80RKRA
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010756  Tls1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF07052  Hep_59  
Amino Acid Sequences MTEAVAQIAFKKRSRPAQTIKRPSQSDGNHDGPIADEQAHEPTDNLEDLLTLRKLRQATRKEGIDLERLNSGEAQRRKRAKRTEGDTNEYGLQSKDRVKDKEDDDYLLDDEDLKTRRLVKSNNFTQQTNTLDVDKHMMAYIEAELRKRTQKNPGQLDVEEELGKLDPHDELYQVAERYRVAKMPVREGNETTSSAMLTAVQEVDLGIDARLRNIEETEKAKQRLRELQNAPRPPKEEEDFNYARERFFRVSAQRADEQALVAAHREAEGLPPLELGKQSNRPLAATDEEVLERYRKRQRQLQQQHKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.64
3 0.67
4 0.73
5 0.82
6 0.85
7 0.87
8 0.86
9 0.8
10 0.75
11 0.74
12 0.67
13 0.64
14 0.61
15 0.55
16 0.47
17 0.44
18 0.4
19 0.32
20 0.29
21 0.22
22 0.14
23 0.11
24 0.12
25 0.15
26 0.15
27 0.14
28 0.12
29 0.12
30 0.14
31 0.14
32 0.13
33 0.09
34 0.09
35 0.1
36 0.14
37 0.14
38 0.13
39 0.14
40 0.18
41 0.21
42 0.27
43 0.36
44 0.39
45 0.46
46 0.52
47 0.54
48 0.52
49 0.54
50 0.51
51 0.49
52 0.42
53 0.35
54 0.31
55 0.28
56 0.26
57 0.23
58 0.22
59 0.24
60 0.3
61 0.35
62 0.41
63 0.5
64 0.56
65 0.64
66 0.72
67 0.72
68 0.75
69 0.75
70 0.77
71 0.75
72 0.75
73 0.67
74 0.59
75 0.51
76 0.42
77 0.36
78 0.25
79 0.19
80 0.15
81 0.19
82 0.23
83 0.28
84 0.3
85 0.33
86 0.39
87 0.41
88 0.46
89 0.43
90 0.38
91 0.32
92 0.32
93 0.29
94 0.22
95 0.19
96 0.11
97 0.1
98 0.12
99 0.13
100 0.12
101 0.13
102 0.17
103 0.2
104 0.25
105 0.3
106 0.34
107 0.42
108 0.49
109 0.56
110 0.55
111 0.52
112 0.49
113 0.48
114 0.42
115 0.35
116 0.28
117 0.21
118 0.19
119 0.19
120 0.19
121 0.15
122 0.12
123 0.09
124 0.08
125 0.07
126 0.08
127 0.08
128 0.08
129 0.09
130 0.1
131 0.11
132 0.13
133 0.19
134 0.21
135 0.24
136 0.31
137 0.36
138 0.44
139 0.5
140 0.52
141 0.48
142 0.45
143 0.45
144 0.36
145 0.31
146 0.22
147 0.16
148 0.12
149 0.09
150 0.09
151 0.06
152 0.05
153 0.04
154 0.06
155 0.06
156 0.06
157 0.07
158 0.08
159 0.11
160 0.11
161 0.11
162 0.1
163 0.1
164 0.12
165 0.12
166 0.12
167 0.13
168 0.17
169 0.18
170 0.26
171 0.3
172 0.32
173 0.33
174 0.33
175 0.33
176 0.31
177 0.3
178 0.23
179 0.18
180 0.14
181 0.12
182 0.11
183 0.08
184 0.06
185 0.06
186 0.05
187 0.05
188 0.05
189 0.04
190 0.05
191 0.04
192 0.05
193 0.04
194 0.06
195 0.06
196 0.07
197 0.08
198 0.08
199 0.09
200 0.1
201 0.12
202 0.14
203 0.18
204 0.25
205 0.31
206 0.34
207 0.38
208 0.4
209 0.44
210 0.5
211 0.51
212 0.55
213 0.55
214 0.61
215 0.66
216 0.72
217 0.7
218 0.65
219 0.62
220 0.56
221 0.56
222 0.49
223 0.46
224 0.41
225 0.45
226 0.42
227 0.41
228 0.45
229 0.39
230 0.36
231 0.31
232 0.32
233 0.25
234 0.26
235 0.31
236 0.3
237 0.37
238 0.41
239 0.45
240 0.43
241 0.43
242 0.43
243 0.36
244 0.3
245 0.24
246 0.2
247 0.15
248 0.13
249 0.12
250 0.09
251 0.09
252 0.09
253 0.07
254 0.09
255 0.13
256 0.13
257 0.13
258 0.13
259 0.14
260 0.15
261 0.16
262 0.17
263 0.2
264 0.26
265 0.31
266 0.35
267 0.36
268 0.35
269 0.36
270 0.37
271 0.34
272 0.29
273 0.26
274 0.23
275 0.23
276 0.23
277 0.23
278 0.24
279 0.22
280 0.27
281 0.37
282 0.42
283 0.49
284 0.57
285 0.66
286 0.72
287 0.81