Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7E907

Protein Details
Accession G7E907    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-78MTPTKRTSANVRSREKRKKAEASADSHydrophilic
NLS Segment(s)
PositionSequence
65-71SREKRKK
Subcellular Location(s) mito 12, extr 5, plas 4, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MSASKDKVTFLSVSASVILLSASIGLKRSHRKAHPLSRPSSQRGSSVKLDVSMTPTKRTSANVRSREKRKKAEASADSIEVLSRMRRNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.11
4 0.11
5 0.09
6 0.05
7 0.04
8 0.05
9 0.05
10 0.05
11 0.07
12 0.08
13 0.14
14 0.21
15 0.27
16 0.34
17 0.37
18 0.46
19 0.54
20 0.63
21 0.67
22 0.66
23 0.65
24 0.64
25 0.66
26 0.61
27 0.56
28 0.47
29 0.43
30 0.39
31 0.4
32 0.34
33 0.31
34 0.26
35 0.22
36 0.22
37 0.17
38 0.2
39 0.21
40 0.2
41 0.22
42 0.22
43 0.22
44 0.23
45 0.26
46 0.29
47 0.33
48 0.42
49 0.48
50 0.56
51 0.64
52 0.74
53 0.81
54 0.82
55 0.81
56 0.81
57 0.81
58 0.8
59 0.81
60 0.75
61 0.71
62 0.66
63 0.58
64 0.49
65 0.39
66 0.31
67 0.21
68 0.19
69 0.16