FuNGI

G7E9Y2

Protein Details

Accession

G7E9Y2

Localization Confidence

Low

Confidence Score

8.5

NoLS Segment(s)

Position	Sequence	Protein Nature
548-567	GRPNPRGPRAALKPTNKKMR	Basic

NLS Segment(s)

Position	Sequence
546-567	AAGRPNPRGPRAALKPTNKKMR

Subcellular Location(s)

cyto 7.5, plas 7, mito 6, cyto_nucl 5, E.R. 3, nucl 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR002937 Amino_oxidase IPR036188 FAD/NAD-bd_sf
Gene Ontology	GO:0016020 C:membrane GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Pfam	View protein in Pfam PF01593 Amino_oxidase

Amino Acid Sequences

MVNIAVVGSGVSGLAATWLLNEHSDHEVHLFEKGTYVGGHTHTVPFKQPRNPTASPVPVDTGFIVFNEVTYPNFLRFLELKKINITGSDMSFAVSRDAGEYEWAGKTPATLFAQWQTLFSPAQWRLVWDIIRFNAFSTEILEQVKSEAKASSSAAGQSIGRYIEKEGYSESFKNNYLLPMTAAIWSTPPDRCALDFPAQTLIRFMHNHHLLQLFDRPRWLTIQNGSISYINAITKSLPPKRLHLNTAVTAVTNTGEGQVMLTLQDGSKQVYDHVILAVHADEALEMLLNGADGATREEAEILGGFQFNKNVAYLHSDPDLMPKRRVAWSAWNYMTKSEEKSDAVDTISLTYWMNLLQNIDEKEHGDVLVTLNPLTKPKPALTVGHWNYEHPLYTEQSVASQGNLHRIQAKRGVTFAGAWTNYGFHEDGFTSGLRVATTYLGVKPPFEIRSAERQTRSDALSEAGKLIIECLDFGRRLLEPFFVAAMIMLVFTALAWEHVLMPLELALRRTTSIAPGILSRRRERAAGTLRESRQLIRQLRKYWATAAGRPNPRGPRAALKPTNKKMR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.04
2	0.04
3	0.04
4	0.04
5	0.06
6	0.07
7	0.09
8	0.09
9	0.12
10	0.15
11	0.15
12	0.16
13	0.16
14	0.17
15	0.16
16	0.18
17	0.16
18	0.13
19	0.15
20	0.14
21	0.14
22	0.13
23	0.14
24	0.14
25	0.15
26	0.17
27	0.17
28	0.23
29	0.24
30	0.26
31	0.33
32	0.38
33	0.43
34	0.5
35	0.56
36	0.57
37	0.63
38	0.64
39	0.62
40	0.62
41	0.62
42	0.56
43	0.5
44	0.47
45	0.38
46	0.38
47	0.32
48	0.24
49	0.17
50	0.15
51	0.15
52	0.11
53	0.11
54	0.11
55	0.11
56	0.11
57	0.14
58	0.16
59	0.15
60	0.17
61	0.17
62	0.2
63	0.22
64	0.27
65	0.32
66	0.34
67	0.35
68	0.36
69	0.38
70	0.33
71	0.32
72	0.3
73	0.23
74	0.21
75	0.21
76	0.18
77	0.17
78	0.17
79	0.16
80	0.14
81	0.11
82	0.1
83	0.09
84	0.1
85	0.1
86	0.1
87	0.1
88	0.11
89	0.12
90	0.12
91	0.11
92	0.1
93	0.11
94	0.11
95	0.16
96	0.16
97	0.16
98	0.18
99	0.2
100	0.25
101	0.24
102	0.24
103	0.19
104	0.19
105	0.19
106	0.17
107	0.23
108	0.19
109	0.24
110	0.23
111	0.24
112	0.25
113	0.29
114	0.31
115	0.24
116	0.27
117	0.23
118	0.25
119	0.24
120	0.21
121	0.19
122	0.17
123	0.15
124	0.14
125	0.14
126	0.13
127	0.14
128	0.14
129	0.12
130	0.13
131	0.16
132	0.14
133	0.14
134	0.13
135	0.13
136	0.15
137	0.16
138	0.16
139	0.13
140	0.13
141	0.13
142	0.13
143	0.12
144	0.1
145	0.11
146	0.11
147	0.1
148	0.1
149	0.11
150	0.15
151	0.16
152	0.16
153	0.16
154	0.17
155	0.21
156	0.22
157	0.23
158	0.21
159	0.22
160	0.22
161	0.21
162	0.2
163	0.17
164	0.16
165	0.14
166	0.12
167	0.12
168	0.12
169	0.11
170	0.1
171	0.09
172	0.1
173	0.12
174	0.11
175	0.11
176	0.12
177	0.13
178	0.14
179	0.16
180	0.19
181	0.23
182	0.22
183	0.23
184	0.28
185	0.27
186	0.26
187	0.24
188	0.2
189	0.18
190	0.19
191	0.2
192	0.22
193	0.25
194	0.25
195	0.26
196	0.27
197	0.24
198	0.24
199	0.3
200	0.23
201	0.21
202	0.23
203	0.21
204	0.2
205	0.23
206	0.22
207	0.18
208	0.19
209	0.24
210	0.23
211	0.22
212	0.23
213	0.21
214	0.2
215	0.16
216	0.15
217	0.1
218	0.09
219	0.08
220	0.08
221	0.11
222	0.19
223	0.23
224	0.29
225	0.3
226	0.34
227	0.42
228	0.45
229	0.44
230	0.43
231	0.41
232	0.35
233	0.36
234	0.32
235	0.23
236	0.19
237	0.17
238	0.11
239	0.08
240	0.06
241	0.05
242	0.05
243	0.04
244	0.04
245	0.04
246	0.04
247	0.04
248	0.04
249	0.04
250	0.04
251	0.06
252	0.06
253	0.07
254	0.08
255	0.08
256	0.08
257	0.09
258	0.1
259	0.08
260	0.08
261	0.07
262	0.06
263	0.07
264	0.06
265	0.05
266	0.04
267	0.04
268	0.03
269	0.03
270	0.03
271	0.02
272	0.02
273	0.02
274	0.02
275	0.02
276	0.02
277	0.02
278	0.02
279	0.02
280	0.04
281	0.04
282	0.04
283	0.04
284	0.05
285	0.05
286	0.05
287	0.05
288	0.04
289	0.04
290	0.04
291	0.04
292	0.05
293	0.05
294	0.06
295	0.06
296	0.06
297	0.06
298	0.06
299	0.13
300	0.14
301	0.15
302	0.15
303	0.15
304	0.15
305	0.23
306	0.3
307	0.26
308	0.27
309	0.26
310	0.28
311	0.3
312	0.32
313	0.27
314	0.29
315	0.31
316	0.37
317	0.38
318	0.39
319	0.36
320	0.36
321	0.36
322	0.27
323	0.25
324	0.2
325	0.2
326	0.17
327	0.18
328	0.19
329	0.17
330	0.15
331	0.13
332	0.12
333	0.11
334	0.1
335	0.09
336	0.08
337	0.07
338	0.07
339	0.07
340	0.07
341	0.07
342	0.07
343	0.07
344	0.11
345	0.12
346	0.13
347	0.13
348	0.13
349	0.13
350	0.13
351	0.12
352	0.09
353	0.08
354	0.08
355	0.1
356	0.1
357	0.09
358	0.1
359	0.11
360	0.13
361	0.14
362	0.15
363	0.15
364	0.16
365	0.21
366	0.21
367	0.24
368	0.26
369	0.36
370	0.36
371	0.4
372	0.39
373	0.34
374	0.34
375	0.32
376	0.28
377	0.19
378	0.2
379	0.14
380	0.15
381	0.16
382	0.14
383	0.13
384	0.15
385	0.13
386	0.11
387	0.13
388	0.13
389	0.2
390	0.21
391	0.21
392	0.25
393	0.26
394	0.29
395	0.32
396	0.35
397	0.28
398	0.28
399	0.29
400	0.23
401	0.23
402	0.21
403	0.2
404	0.17
405	0.16
406	0.15
407	0.15
408	0.14
409	0.16
410	0.14
411	0.08
412	0.1
413	0.1
414	0.11
415	0.11
416	0.11
417	0.09
418	0.1
419	0.11
420	0.09
421	0.09
422	0.09
423	0.08
424	0.09
425	0.1
426	0.11
427	0.15
428	0.15
429	0.15
430	0.16
431	0.21
432	0.21
433	0.21
434	0.22
435	0.22
436	0.33
437	0.4
438	0.45
439	0.43
440	0.44
441	0.46
442	0.47
443	0.44
444	0.35
445	0.29
446	0.24
447	0.23
448	0.22
449	0.18
450	0.14
451	0.13
452	0.11
453	0.11
454	0.1
455	0.08
456	0.08
457	0.09
458	0.12
459	0.12
460	0.13
461	0.15
462	0.14
463	0.16
464	0.17
465	0.17
466	0.14
467	0.15
468	0.15
469	0.12
470	0.11
471	0.09
472	0.08
473	0.06
474	0.05
475	0.04
476	0.03
477	0.03
478	0.03
479	0.04
480	0.03
481	0.04
482	0.04
483	0.05
484	0.06
485	0.07
486	0.09
487	0.08
488	0.08
489	0.09
490	0.11
491	0.12
492	0.13
493	0.13
494	0.13
495	0.14
496	0.16
497	0.15
498	0.16
499	0.19
500	0.19
501	0.18
502	0.22
503	0.28
504	0.32
505	0.38
506	0.39
507	0.42
508	0.43
509	0.44
510	0.42
511	0.45
512	0.49
513	0.51
514	0.53
515	0.56
516	0.55
517	0.6
518	0.59
519	0.51
520	0.48
521	0.5
522	0.52
523	0.53
524	0.6
525	0.59
526	0.66
527	0.68
528	0.63
529	0.58
530	0.58
531	0.54
532	0.52
533	0.56
534	0.58
535	0.61
536	0.62
537	0.66
538	0.65
539	0.63
540	0.61
541	0.56
542	0.56
543	0.57
544	0.64
545	0.66
546	0.68
547	0.75

G7E9Y2

3D AlphaFold-predicted Structure Viewer