Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7DZN9

Protein Details
Accession G7DZN9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-93MELIRNSKDKKARKLTKRKLGTLRRAKRKVDEBasic
NLS Segment(s)
PositionSequence
33-38RKGKAS
67-90NSKDKKARKLTKRKLGTLRRAKRK
Subcellular Location(s) mito 16, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MARTAVQRSGLPVGKNAGHITTVRALPDKPSNRKGKASKRSIFVRSVVRDVAGYAPYERRVMELIRNSKDKKARKLTKRKLGTLRRAKRKVDELTGVIAEQRRGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.27
4 0.21
5 0.19
6 0.18
7 0.19
8 0.19
9 0.19
10 0.18
11 0.19
12 0.18
13 0.21
14 0.3
15 0.35
16 0.39
17 0.47
18 0.54
19 0.56
20 0.64
21 0.69
22 0.71
23 0.72
24 0.75
25 0.71
26 0.69
27 0.71
28 0.66
29 0.59
30 0.52
31 0.49
32 0.41
33 0.38
34 0.32
35 0.26
36 0.22
37 0.2
38 0.17
39 0.11
40 0.09
41 0.08
42 0.09
43 0.1
44 0.11
45 0.1
46 0.09
47 0.1
48 0.11
49 0.15
50 0.22
51 0.27
52 0.3
53 0.36
54 0.37
55 0.42
56 0.49
57 0.52
58 0.54
59 0.59
60 0.65
61 0.71
62 0.8
63 0.85
64 0.87
65 0.87
66 0.86
67 0.86
68 0.86
69 0.86
70 0.85
71 0.85
72 0.86
73 0.85
74 0.81
75 0.78
76 0.77
77 0.73
78 0.68
79 0.64
80 0.55
81 0.51
82 0.47
83 0.4
84 0.34
85 0.29
86 0.23