Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7DW04

Protein Details
Accession G7DW04    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AIAPPIVKKRTHKFKRHQSDRYAGLKENWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-46KKRTHKFKRHQSDRYAGLKENWRKPKGIDNRVRRRFKG
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIAPPIVKKRTHKFKRHQSDRYAGLKENWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKATKHMMPNRLYKMVVSNVSELNLLLMHNKTYAAEIAHNISSKNRITLLERAKALGIKVTNASARLRKEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.84
3 0.9
4 0.93
5 0.91
6 0.87
7 0.85
8 0.82
9 0.78
10 0.7
11 0.61
12 0.56
13 0.57
14 0.57
15 0.59
16 0.61
17 0.56
18 0.54
19 0.54
20 0.58
21 0.59
22 0.61
23 0.61
24 0.63
25 0.72
26 0.81
27 0.85
28 0.77
29 0.75
30 0.72
31 0.69
32 0.69
33 0.66
34 0.67
35 0.68
36 0.71
37 0.65
38 0.58
39 0.51
40 0.45
41 0.41
42 0.34
43 0.31
44 0.33
45 0.32
46 0.32
47 0.33
48 0.3
49 0.33
50 0.36
51 0.39
52 0.35
53 0.41
54 0.44
55 0.44
56 0.43
57 0.34
58 0.31
59 0.26
60 0.24
61 0.19
62 0.17
63 0.16
64 0.16
65 0.16
66 0.13
67 0.1
68 0.08
69 0.06
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.09
78 0.08
79 0.09
80 0.1
81 0.12
82 0.14
83 0.15
84 0.14
85 0.15
86 0.18
87 0.18
88 0.19
89 0.18
90 0.18
91 0.21
92 0.3
93 0.35
94 0.37
95 0.36
96 0.36
97 0.35
98 0.35
99 0.31
100 0.28
101 0.22
102 0.18
103 0.19
104 0.21
105 0.21
106 0.22
107 0.27
108 0.28
109 0.31