Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S8Z9

Protein Details
Accession E3S8Z9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
202-224MSVGKGKKKKKPIVPRPTPKPTDBasic
NLS Segment(s)
PositionSequence
205-219GKGKKKKKPIVPRPT
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018800  PRCC  
KEGG pte:PTT_19489  -  
Pfam View protein in Pfam  
PF10253  PRCC  
Amino Acid Sequences MNLLAGYSDSESDSEASSAPNMAAKPASKPSFQKVVDRSNPGRIKVSLPGASQLRQDKDDIQDDAPPAKKPRLGGGSSFGGFNAMLPAPKKPNLNAISTSDSTKTGSRGLGKGLASGINLKTGAEPAFKREPRVEMDEYDETGNPIKKEPMKKEDFRAMLNLPPPKTETKKDTQGEAPVEDAKVVPAPQQVPKPAAPRFVPMSVGKGKKKKKPIVPRPTPKPTDGTSTPSTNAQTPHAQLTNTAPRKPKVSLFGVSNEPEPVAKPPIDTEYQPLLYGADEEQAPAIPSEPFPDHSAYTNTQPTPAPSGPSDLTNIASELNLTPAERRQLFGKQRRDAPDLSSAHIAEFNTDAEYAHNEKLRQQGEAVSHNPLKSITGTGKNSLRSLVNVATTQKEALEDHFAAGHRNKKEAGNRYGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.11
6 0.11
7 0.13
8 0.12
9 0.13
10 0.16
11 0.17
12 0.21
13 0.3
14 0.33
15 0.35
16 0.39
17 0.44
18 0.51
19 0.52
20 0.56
21 0.54
22 0.6
23 0.63
24 0.67
25 0.64
26 0.64
27 0.67
28 0.61
29 0.58
30 0.5
31 0.46
32 0.43
33 0.46
34 0.4
35 0.36
36 0.4
37 0.38
38 0.38
39 0.4
40 0.41
41 0.38
42 0.35
43 0.36
44 0.34
45 0.37
46 0.4
47 0.37
48 0.31
49 0.32
50 0.32
51 0.35
52 0.33
53 0.32
54 0.32
55 0.33
56 0.34
57 0.32
58 0.38
59 0.4
60 0.4
61 0.38
62 0.39
63 0.39
64 0.37
65 0.35
66 0.27
67 0.2
68 0.18
69 0.15
70 0.13
71 0.09
72 0.11
73 0.12
74 0.16
75 0.2
76 0.24
77 0.27
78 0.25
79 0.34
80 0.35
81 0.39
82 0.37
83 0.37
84 0.39
85 0.38
86 0.38
87 0.3
88 0.27
89 0.25
90 0.24
91 0.21
92 0.17
93 0.19
94 0.21
95 0.21
96 0.23
97 0.26
98 0.24
99 0.23
100 0.22
101 0.19
102 0.16
103 0.18
104 0.16
105 0.13
106 0.12
107 0.12
108 0.11
109 0.12
110 0.13
111 0.14
112 0.14
113 0.18
114 0.28
115 0.29
116 0.32
117 0.32
118 0.34
119 0.35
120 0.41
121 0.37
122 0.29
123 0.34
124 0.32
125 0.3
126 0.28
127 0.24
128 0.18
129 0.19
130 0.21
131 0.15
132 0.15
133 0.19
134 0.24
135 0.32
136 0.38
137 0.44
138 0.49
139 0.52
140 0.56
141 0.59
142 0.55
143 0.48
144 0.45
145 0.37
146 0.32
147 0.34
148 0.33
149 0.25
150 0.24
151 0.26
152 0.28
153 0.31
154 0.32
155 0.33
156 0.35
157 0.44
158 0.44
159 0.45
160 0.42
161 0.43
162 0.4
163 0.34
164 0.29
165 0.21
166 0.2
167 0.16
168 0.14
169 0.09
170 0.08
171 0.08
172 0.08
173 0.09
174 0.11
175 0.14
176 0.17
177 0.19
178 0.21
179 0.24
180 0.27
181 0.27
182 0.29
183 0.26
184 0.27
185 0.28
186 0.25
187 0.25
188 0.2
189 0.23
190 0.25
191 0.3
192 0.32
193 0.38
194 0.45
195 0.48
196 0.58
197 0.62
198 0.65
199 0.71
200 0.77
201 0.8
202 0.83
203 0.86
204 0.85
205 0.86
206 0.79
207 0.69
208 0.62
209 0.52
210 0.48
211 0.4
212 0.37
213 0.31
214 0.3
215 0.29
216 0.27
217 0.27
218 0.22
219 0.21
220 0.18
221 0.18
222 0.18
223 0.2
224 0.19
225 0.18
226 0.17
227 0.21
228 0.29
229 0.29
230 0.32
231 0.33
232 0.33
233 0.36
234 0.38
235 0.36
236 0.31
237 0.32
238 0.31
239 0.3
240 0.32
241 0.32
242 0.31
243 0.28
244 0.22
245 0.18
246 0.15
247 0.14
248 0.13
249 0.12
250 0.12
251 0.11
252 0.12
253 0.16
254 0.17
255 0.17
256 0.19
257 0.21
258 0.21
259 0.21
260 0.19
261 0.16
262 0.14
263 0.14
264 0.1
265 0.07
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.06
272 0.07
273 0.06
274 0.06
275 0.1
276 0.11
277 0.13
278 0.14
279 0.16
280 0.16
281 0.18
282 0.22
283 0.21
284 0.24
285 0.28
286 0.26
287 0.26
288 0.26
289 0.25
290 0.28
291 0.27
292 0.25
293 0.2
294 0.25
295 0.23
296 0.24
297 0.24
298 0.18
299 0.19
300 0.16
301 0.16
302 0.12
303 0.11
304 0.1
305 0.09
306 0.09
307 0.08
308 0.08
309 0.1
310 0.12
311 0.19
312 0.19
313 0.2
314 0.22
315 0.31
316 0.41
317 0.49
318 0.56
319 0.56
320 0.63
321 0.68
322 0.7
323 0.62
324 0.55
325 0.55
326 0.47
327 0.43
328 0.38
329 0.32
330 0.28
331 0.28
332 0.24
333 0.16
334 0.15
335 0.13
336 0.11
337 0.11
338 0.11
339 0.09
340 0.14
341 0.16
342 0.19
343 0.22
344 0.22
345 0.26
346 0.34
347 0.34
348 0.31
349 0.29
350 0.29
351 0.31
352 0.36
353 0.34
354 0.33
355 0.35
356 0.34
357 0.34
358 0.29
359 0.26
360 0.22
361 0.24
362 0.23
363 0.29
364 0.32
365 0.37
366 0.42
367 0.43
368 0.43
369 0.41
370 0.36
371 0.3
372 0.31
373 0.28
374 0.26
375 0.26
376 0.28
377 0.28
378 0.27
379 0.26
380 0.22
381 0.2
382 0.18
383 0.18
384 0.23
385 0.2
386 0.2
387 0.23
388 0.22
389 0.26
390 0.31
391 0.36
392 0.32
393 0.35
394 0.37
395 0.42
396 0.51
397 0.55