Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2YGS6

Protein Details
Accession A0A0D2YGS6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-79ELDSEIPRKKRTKKTQDRDDKIHETBasic
NLS Segment(s)
PositionSequence
63-65KKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGKKSQKAVGQLTAQRRYELRSRRSAVCSDNKATGTPNTGATDEAADQGGSKLFELDSEIPRKKRTKKTQDRDDKIHETESPVLVGGYELGSYSNNSDRQVTNMIRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.45
4 0.44
5 0.45
6 0.48
7 0.46
8 0.48
9 0.52
10 0.55
11 0.58
12 0.58
13 0.56
14 0.55
15 0.54
16 0.47
17 0.46
18 0.41
19 0.38
20 0.36
21 0.3
22 0.25
23 0.21
24 0.2
25 0.17
26 0.17
27 0.17
28 0.15
29 0.14
30 0.11
31 0.1
32 0.08
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.04
41 0.05
42 0.07
43 0.09
44 0.12
45 0.18
46 0.22
47 0.23
48 0.29
49 0.36
50 0.43
51 0.51
52 0.59
53 0.65
54 0.73
55 0.82
56 0.87
57 0.92
58 0.9
59 0.86
60 0.83
61 0.77
62 0.68
63 0.59
64 0.49
65 0.41
66 0.37
67 0.3
68 0.22
69 0.17
70 0.14
71 0.12
72 0.11
73 0.08
74 0.05
75 0.05
76 0.04
77 0.05
78 0.06
79 0.07
80 0.1
81 0.15
82 0.17
83 0.19
84 0.22
85 0.22
86 0.26
87 0.33