Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DJE2

Protein Details
Accession A0A0C4DJE2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-114EKQFNGPKRINPRKPLRRCQEWTRETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 7.5, cyto 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046670  DUF6540  
KEGG fox:FOXG_17592  -  
Pfam View protein in Pfam  
PF20174  DUF6540  
Amino Acid Sequences MSYLSVYLVEYTGGQRNHHSIFVKNAQDDAGTLFHVTGDIQRGCTLEIRPTRKSPRLSATFEAWSQIGVIAANDMPRVQAICEANPPPEKQFNGPKRINPRKPLRRCQEWTRETIDMLREQGVLLDSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.26
4 0.27
5 0.31
6 0.3
7 0.27
8 0.32
9 0.39
10 0.4
11 0.36
12 0.34
13 0.3
14 0.28
15 0.26
16 0.2
17 0.13
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.07
24 0.07
25 0.11
26 0.11
27 0.12
28 0.13
29 0.13
30 0.14
31 0.16
32 0.15
33 0.17
34 0.24
35 0.28
36 0.31
37 0.37
38 0.44
39 0.48
40 0.51
41 0.49
42 0.5
43 0.51
44 0.52
45 0.48
46 0.44
47 0.39
48 0.35
49 0.32
50 0.23
51 0.17
52 0.12
53 0.09
54 0.06
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.04
66 0.09
67 0.1
68 0.11
69 0.15
70 0.16
71 0.19
72 0.22
73 0.23
74 0.22
75 0.26
76 0.27
77 0.28
78 0.38
79 0.42
80 0.49
81 0.51
82 0.54
83 0.61
84 0.7
85 0.73
86 0.73
87 0.76
88 0.78
89 0.84
90 0.88
91 0.86
92 0.85
93 0.85
94 0.85
95 0.85
96 0.78
97 0.73
98 0.69
99 0.61
100 0.52
101 0.48
102 0.42
103 0.34
104 0.31
105 0.27
106 0.21
107 0.19
108 0.19