Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XK91

Protein Details
Accession A0A0D2XK91    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
435-456AYFRMRNADRKVGRKRNPILDIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013057  AA_transpt_TM  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01490  Aa_trans  
Amino Acid Sequences MDKTSTLEDSELQTSRTPSRRPWLASAFGGPNVTIGPRIEPLAEHLAHVSESDSTAAEDLVDKQVASEAGNAIQYRTCSWQKTAGLLFSEYIVLSIMSFPWSYSLLGLVPGLILTAVIAGLVLYTSLVLWEFCLRHPEVRDVCDIGQMIWWNKRWAWWWTAVMFVLNNTFIQALHVLVGAIYLNTMTEADSIAGCRTVAFAAVVTVISWIGSLPRTFSMLSKLGFASTFFTFISVILATAFAGAQGKPAGYPEMGEPIISIWTPKTTTLVTGMSAFMNMSYTFIGQTTIPSFIAEMRDPRDFPKALWACTMAEIVTFSVVGSVIYVYTGNQYMVTPAFGVLTDTYKKVSYSFMVPTIIFVGCLYASVTGRFVFFRMFKDSEHLTSHTFKGWFWWGLVLLISWAASFFIAEIIPFFSSFMSSLFNCWFGFIFWALAYFRMRNADRKVGRKRNPILDILSVALNVVIMLTGALYLTLGTYVSVQGIIDQFRAGQVSSVFSCKSNGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.39
4 0.39
5 0.41
6 0.5
7 0.56
8 0.59
9 0.63
10 0.61
11 0.59
12 0.57
13 0.56
14 0.49
15 0.43
16 0.38
17 0.3
18 0.24
19 0.19
20 0.18
21 0.14
22 0.12
23 0.13
24 0.13
25 0.15
26 0.14
27 0.14
28 0.18
29 0.23
30 0.23
31 0.21
32 0.2
33 0.2
34 0.19
35 0.19
36 0.15
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.09
43 0.08
44 0.08
45 0.08
46 0.1
47 0.12
48 0.12
49 0.11
50 0.11
51 0.13
52 0.14
53 0.13
54 0.13
55 0.11
56 0.12
57 0.15
58 0.15
59 0.14
60 0.15
61 0.15
62 0.16
63 0.21
64 0.25
65 0.25
66 0.28
67 0.35
68 0.34
69 0.39
70 0.4
71 0.36
72 0.33
73 0.31
74 0.29
75 0.21
76 0.2
77 0.14
78 0.12
79 0.09
80 0.07
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.07
87 0.08
88 0.09
89 0.09
90 0.09
91 0.1
92 0.08
93 0.09
94 0.09
95 0.07
96 0.06
97 0.05
98 0.05
99 0.04
100 0.03
101 0.02
102 0.03
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.04
117 0.08
118 0.09
119 0.1
120 0.15
121 0.16
122 0.2
123 0.23
124 0.3
125 0.3
126 0.31
127 0.33
128 0.31
129 0.3
130 0.28
131 0.26
132 0.18
133 0.17
134 0.17
135 0.18
136 0.2
137 0.22
138 0.21
139 0.21
140 0.24
141 0.26
142 0.26
143 0.27
144 0.27
145 0.28
146 0.26
147 0.27
148 0.25
149 0.21
150 0.18
151 0.15
152 0.11
153 0.09
154 0.08
155 0.07
156 0.07
157 0.06
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.05
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.04
176 0.05
177 0.05
178 0.05
179 0.06
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.04
188 0.04
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.03
196 0.03
197 0.04
198 0.05
199 0.05
200 0.06
201 0.07
202 0.08
203 0.09
204 0.1
205 0.13
206 0.15
207 0.16
208 0.16
209 0.15
210 0.14
211 0.14
212 0.14
213 0.12
214 0.09
215 0.1
216 0.08
217 0.09
218 0.09
219 0.08
220 0.09
221 0.06
222 0.06
223 0.05
224 0.05
225 0.04
226 0.04
227 0.04
228 0.03
229 0.04
230 0.04
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.05
238 0.06
239 0.06
240 0.09
241 0.09
242 0.09
243 0.08
244 0.07
245 0.08
246 0.07
247 0.07
248 0.04
249 0.06
250 0.06
251 0.07
252 0.08
253 0.08
254 0.08
255 0.1
256 0.11
257 0.1
258 0.1
259 0.11
260 0.09
261 0.09
262 0.08
263 0.06
264 0.06
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.06
271 0.07
272 0.05
273 0.07
274 0.07
275 0.08
276 0.08
277 0.08
278 0.08
279 0.08
280 0.11
281 0.11
282 0.12
283 0.13
284 0.15
285 0.16
286 0.18
287 0.22
288 0.2
289 0.19
290 0.28
291 0.27
292 0.26
293 0.27
294 0.26
295 0.21
296 0.22
297 0.22
298 0.11
299 0.09
300 0.09
301 0.07
302 0.06
303 0.05
304 0.04
305 0.04
306 0.04
307 0.04
308 0.03
309 0.03
310 0.03
311 0.04
312 0.04
313 0.04
314 0.05
315 0.06
316 0.06
317 0.06
318 0.07
319 0.08
320 0.08
321 0.08
322 0.07
323 0.06
324 0.06
325 0.06
326 0.07
327 0.06
328 0.09
329 0.1
330 0.11
331 0.12
332 0.13
333 0.13
334 0.13
335 0.14
336 0.13
337 0.15
338 0.17
339 0.18
340 0.19
341 0.18
342 0.18
343 0.18
344 0.16
345 0.12
346 0.1
347 0.09
348 0.07
349 0.07
350 0.07
351 0.07
352 0.07
353 0.08
354 0.09
355 0.09
356 0.1
357 0.1
358 0.1
359 0.12
360 0.13
361 0.16
362 0.21
363 0.22
364 0.22
365 0.27
366 0.29
367 0.28
368 0.3
369 0.29
370 0.26
371 0.28
372 0.29
373 0.29
374 0.26
375 0.23
376 0.24
377 0.27
378 0.24
379 0.21
380 0.22
381 0.17
382 0.17
383 0.18
384 0.13
385 0.09
386 0.08
387 0.07
388 0.05
389 0.05
390 0.04
391 0.04
392 0.04
393 0.04
394 0.05
395 0.05
396 0.05
397 0.05
398 0.07
399 0.07
400 0.08
401 0.08
402 0.07
403 0.08
404 0.08
405 0.09
406 0.1
407 0.1
408 0.13
409 0.14
410 0.16
411 0.15
412 0.15
413 0.15
414 0.12
415 0.14
416 0.12
417 0.12
418 0.09
419 0.12
420 0.11
421 0.13
422 0.16
423 0.14
424 0.15
425 0.22
426 0.24
427 0.3
428 0.36
429 0.44
430 0.49
431 0.58
432 0.67
433 0.7
434 0.78
435 0.8
436 0.82
437 0.82
438 0.79
439 0.74
440 0.67
441 0.59
442 0.51
443 0.42
444 0.35
445 0.25
446 0.2
447 0.15
448 0.1
449 0.07
450 0.05
451 0.03
452 0.03
453 0.03
454 0.03
455 0.03
456 0.03
457 0.03
458 0.03
459 0.03
460 0.03
461 0.04
462 0.04
463 0.04
464 0.05
465 0.06
466 0.06
467 0.07
468 0.07
469 0.09
470 0.12
471 0.13
472 0.13
473 0.13
474 0.12
475 0.13
476 0.15
477 0.12
478 0.12
479 0.11
480 0.15
481 0.17
482 0.2
483 0.2
484 0.2