Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Y844

Protein Details
Accession A0A0D2Y844    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45CLVRLGRKIFRQKYNQTKRPNGRNLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 11.5, mito 8.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MASITNVTIRQEDEKSGLRCLVRLGRKIFRQKYNQTKRPNGRNLGRCGSNESYSRRPVCRWSMEKRYNPWAPLDVSERKKCATSTSKKGARLCGAFLVMGVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.31
4 0.32
5 0.28
6 0.27
7 0.29
8 0.33
9 0.32
10 0.36
11 0.4
12 0.44
13 0.51
14 0.61
15 0.65
16 0.65
17 0.68
18 0.71
19 0.76
20 0.8
21 0.81
22 0.79
23 0.82
24 0.82
25 0.83
26 0.81
27 0.78
28 0.75
29 0.74
30 0.71
31 0.65
32 0.58
33 0.49
34 0.47
35 0.41
36 0.35
37 0.32
38 0.31
39 0.31
40 0.33
41 0.36
42 0.31
43 0.31
44 0.33
45 0.35
46 0.39
47 0.41
48 0.44
49 0.52
50 0.59
51 0.63
52 0.63
53 0.65
54 0.61
55 0.56
56 0.5
57 0.42
58 0.35
59 0.32
60 0.33
61 0.33
62 0.37
63 0.4
64 0.4
65 0.38
66 0.38
67 0.36
68 0.38
69 0.4
70 0.42
71 0.47
72 0.56
73 0.61
74 0.66
75 0.7
76 0.68
77 0.66
78 0.59
79 0.52
80 0.45
81 0.39
82 0.32