Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2YGR0

Protein Details
Accession A0A0D2YGR0    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDSRTRRERLSKEKQQHFLGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, nucl 9, cyto_mito 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022198  DUF3723  
Pfam View protein in Pfam  
PF12520  DUF3723  
Amino Acid Sequences MDSRTRRERLSKEKQQHFLGIASIRFGALDFDWCRQRNPLSGSLDQKNVASLETMFRRGCDWSPEQVSHQIPALIDPALLEESLQRAEKSLSLEDLKKEDGVFAELDLADGRVICLKGEHRVLASDATVVNRKKRWIVRLYSTGIQGFPEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.72
4 0.64
5 0.54
6 0.47
7 0.4
8 0.31
9 0.25
10 0.21
11 0.17
12 0.14
13 0.13
14 0.11
15 0.08
16 0.13
17 0.14
18 0.18
19 0.25
20 0.26
21 0.27
22 0.29
23 0.31
24 0.32
25 0.35
26 0.38
27 0.37
28 0.41
29 0.45
30 0.45
31 0.44
32 0.38
33 0.33
34 0.27
35 0.22
36 0.17
37 0.12
38 0.09
39 0.12
40 0.13
41 0.17
42 0.15
43 0.15
44 0.16
45 0.17
46 0.18
47 0.19
48 0.2
49 0.21
50 0.24
51 0.24
52 0.25
53 0.29
54 0.28
55 0.24
56 0.21
57 0.18
58 0.14
59 0.14
60 0.13
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.05
70 0.06
71 0.07
72 0.06
73 0.07
74 0.08
75 0.09
76 0.11
77 0.11
78 0.12
79 0.14
80 0.16
81 0.17
82 0.18
83 0.17
84 0.16
85 0.15
86 0.13
87 0.11
88 0.11
89 0.1
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.07
96 0.05
97 0.05
98 0.05
99 0.07
100 0.07
101 0.07
102 0.09
103 0.1
104 0.16
105 0.18
106 0.19
107 0.17
108 0.18
109 0.2
110 0.19
111 0.17
112 0.14
113 0.12
114 0.14
115 0.2
116 0.22
117 0.27
118 0.3
119 0.33
120 0.4
121 0.46
122 0.52
123 0.54
124 0.59
125 0.61
126 0.66
127 0.68
128 0.63
129 0.59
130 0.52
131 0.44