Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2YEM2

Protein Details
Accession A0A0D2YEM2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MQPKPKPKQMLKPKLKQMPKLKQMPKLKQMPKPKQMQMHydrophilic
NLS Segment(s)
PositionSequence
4-57KPKPKQMLKPKLKQMPKLKQMPKLKQMPKPKQMQMLKPKQMQMLKPKQMPKPKL
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MQPKPKPKQMLKPKLKQMPKLKQMPKLKQMPKPKQMQMLKPKQMQMLKPKQMPKPKLKQMQMLKPKQMQMLKPKQMQMLKPKQMQMLKPKQMQMLKPKQMQMLKQMQIPKQMQIPKQMQIPKPMVTSPPKHLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.86
4 0.85
5 0.85
6 0.84
7 0.84
8 0.81
9 0.8
10 0.83
11 0.82
12 0.81
13 0.8
14 0.79
15 0.77
16 0.81
17 0.82
18 0.8
19 0.8
20 0.75
21 0.75
22 0.74
23 0.75
24 0.74
25 0.75
26 0.74
27 0.69
28 0.67
29 0.64
30 0.62
31 0.57
32 0.57
33 0.57
34 0.56
35 0.58
36 0.62
37 0.63
38 0.68
39 0.7
40 0.69
41 0.68
42 0.7
43 0.73
44 0.7
45 0.71
46 0.69
47 0.72
48 0.72
49 0.67
50 0.63
51 0.58
52 0.58
53 0.55
54 0.52
55 0.48
56 0.49
57 0.54
58 0.57
59 0.57
60 0.57
61 0.57
62 0.57
63 0.57
64 0.57
65 0.57
66 0.57
67 0.57
68 0.57
69 0.57
70 0.57
71 0.57
72 0.57
73 0.57
74 0.57
75 0.57
76 0.57
77 0.57
78 0.57
79 0.57
80 0.57
81 0.57
82 0.57
83 0.57
84 0.57
85 0.57
86 0.57
87 0.54
88 0.52
89 0.51
90 0.45
91 0.45
92 0.49
93 0.45
94 0.5
95 0.49
96 0.43
97 0.41
98 0.46
99 0.44
100 0.47
101 0.49
102 0.44
103 0.5
104 0.55
105 0.52
106 0.53
107 0.54
108 0.48
109 0.47
110 0.45
111 0.45
112 0.45
113 0.47