Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3REW5

Protein Details
Accession E3REW5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MTKRTTTTKTTKKPIAKPTKTPTKKNMPKKSPQNPKLTNPHydrophilic
NLS Segment(s)
PositionSequence
12-31KKPIAKPTKTPTKKNMPKKS
Subcellular Location(s) nucl 16.5, mito_nucl 12.5, mito 7.5
Family & Domain DBs
KEGG pte:PTT_05231  -  
Amino Acid Sequences MTKRTTTTKTTKKPIAKPTKTPTKKNMPKKSPQNPKLTNPTTTTTRDTYNLRDRSNRTVGFYNETRLAKAALLPPPPPAAPVKKVKVRAPSSPMPAVKVGGSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.81
4 0.81
5 0.81
6 0.84
7 0.82
8 0.81
9 0.78
10 0.78
11 0.81
12 0.82
13 0.83
14 0.8
15 0.83
16 0.86
17 0.88
18 0.88
19 0.86
20 0.86
21 0.8
22 0.78
23 0.78
24 0.71
25 0.64
26 0.55
27 0.51
28 0.45
29 0.42
30 0.39
31 0.3
32 0.29
33 0.28
34 0.27
35 0.29
36 0.34
37 0.36
38 0.34
39 0.38
40 0.39
41 0.43
42 0.47
43 0.42
44 0.36
45 0.35
46 0.34
47 0.34
48 0.32
49 0.28
50 0.28
51 0.27
52 0.24
53 0.21
54 0.21
55 0.15
56 0.17
57 0.19
58 0.18
59 0.2
60 0.2
61 0.21
62 0.23
63 0.23
64 0.22
65 0.22
66 0.23
67 0.27
68 0.35
69 0.41
70 0.46
71 0.52
72 0.56
73 0.62
74 0.62
75 0.63
76 0.62
77 0.61
78 0.61
79 0.62
80 0.58
81 0.51
82 0.47
83 0.41