Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XGI6

Protein Details
Accession A0A0D2XGI6    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-109QEPSRRRKSRHTSSRDSDRHSBasic
NLS Segment(s)
PositionSequence
94-97RRKS
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
KEGG fox:FOXG_03029  -  
CDD cd00048  DSRM_SF  
Amino Acid Sequences MGGFYMQYLESLCRRRGWTDPMYECYRDHNGYTCLVLVNGREYQTDLAYESDVLAQENAAMRAFMVCRNFSVNGGMLARNGIVQGLPAQEPSRRRKSRHTSSRDSDRHSRRSGHHSSSSSTASFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.38
4 0.42
5 0.43
6 0.47
7 0.49
8 0.5
9 0.53
10 0.51
11 0.46
12 0.44
13 0.43
14 0.35
15 0.32
16 0.3
17 0.27
18 0.26
19 0.26
20 0.21
21 0.16
22 0.14
23 0.14
24 0.1
25 0.11
26 0.12
27 0.12
28 0.11
29 0.12
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.05
50 0.06
51 0.07
52 0.08
53 0.08
54 0.09
55 0.11
56 0.12
57 0.12
58 0.13
59 0.11
60 0.11
61 0.12
62 0.11
63 0.09
64 0.09
65 0.08
66 0.07
67 0.06
68 0.05
69 0.04
70 0.04
71 0.05
72 0.06
73 0.07
74 0.08
75 0.09
76 0.13
77 0.2
78 0.28
79 0.37
80 0.42
81 0.47
82 0.56
83 0.66
84 0.74
85 0.78
86 0.79
87 0.78
88 0.8
89 0.87
90 0.82
91 0.79
92 0.78
93 0.76
94 0.75
95 0.7
96 0.68
97 0.63
98 0.66
99 0.67
100 0.64
101 0.64
102 0.58
103 0.57
104 0.56
105 0.53