Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2XX00

Protein Details
Accession A0A0D2XX00    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-52PDGPWRRKVTKVKKELIHKAKVBasic
170-189RERFKKAMAKTRDRNGNKKLBasic
NLS Segment(s)
PositionSequence
17-62KKPKHGFRVGPENLPDGPWRRKVTKVKKELIHKAKVKKAYAKIKAR
152-191KRREFERRQEERAQKIAERERFKKAMAKTRDRNGNKKLGR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
KEGG fox:FOXG_08516  -  
Amino Acid Sequences MAPKHQNEGGDAAPEAKKPKHGFRVGPENLPDGPWRRKVTKVKKELIHKAKVKKAYAKIKAREQQNAPAPKTSEPVQDEAPVEDTSEEKQPEEEGEEMHPTRQLMLADEAKAQENSVGEPTSDGNRRRTRRPGYYDKQLAKAAQRQEEAEMKRREFERRQEERAQKIAERERFKKAMAKTRDRNGNKKLGRESSLLLDKVRKLVAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.23
4 0.3
5 0.34
6 0.43
7 0.49
8 0.55
9 0.58
10 0.62
11 0.71
12 0.66
13 0.66
14 0.58
15 0.51
16 0.44
17 0.4
18 0.36
19 0.32
20 0.34
21 0.37
22 0.4
23 0.4
24 0.49
25 0.59
26 0.66
27 0.7
28 0.73
29 0.74
30 0.76
31 0.82
32 0.83
33 0.81
34 0.79
35 0.76
36 0.75
37 0.74
38 0.74
39 0.7
40 0.67
41 0.68
42 0.68
43 0.71
44 0.72
45 0.71
46 0.73
47 0.74
48 0.71
49 0.69
50 0.62
51 0.6
52 0.59
53 0.61
54 0.53
55 0.5
56 0.47
57 0.4
58 0.39
59 0.33
60 0.31
61 0.25
62 0.26
63 0.23
64 0.24
65 0.23
66 0.21
67 0.22
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.13
74 0.13
75 0.11
76 0.11
77 0.11
78 0.11
79 0.12
80 0.11
81 0.08
82 0.09
83 0.12
84 0.12
85 0.12
86 0.12
87 0.1
88 0.1
89 0.11
90 0.1
91 0.08
92 0.11
93 0.12
94 0.12
95 0.13
96 0.13
97 0.12
98 0.12
99 0.11
100 0.09
101 0.08
102 0.08
103 0.08
104 0.08
105 0.07
106 0.08
107 0.09
108 0.12
109 0.17
110 0.19
111 0.26
112 0.35
113 0.39
114 0.45
115 0.53
116 0.57
117 0.61
118 0.67
119 0.69
120 0.67
121 0.73
122 0.75
123 0.69
124 0.65
125 0.58
126 0.52
127 0.46
128 0.45
129 0.4
130 0.37
131 0.35
132 0.32
133 0.33
134 0.38
135 0.37
136 0.4
137 0.4
138 0.36
139 0.39
140 0.41
141 0.45
142 0.45
143 0.51
144 0.53
145 0.55
146 0.61
147 0.66
148 0.71
149 0.7
150 0.7
151 0.63
152 0.55
153 0.56
154 0.58
155 0.57
156 0.58
157 0.55
158 0.57
159 0.55
160 0.55
161 0.54
162 0.52
163 0.54
164 0.56
165 0.62
166 0.63
167 0.7
168 0.79
169 0.79
170 0.8
171 0.77
172 0.78
173 0.73
174 0.72
175 0.71
176 0.67
177 0.64
178 0.58
179 0.53
180 0.5
181 0.52
182 0.46
183 0.4
184 0.39
185 0.37
186 0.38
187 0.36