Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XZH4

Protein Details
Accession A0A0D2XZH4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-92NYISCFRHRRQRQISPAPSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 7, cyto_mito 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR006722  Sedlin  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
Pfam View protein in Pfam  
PF04628  Sedlin_N  
CDD cd14825  TRAPPC2_sedlin  
Amino Acid Sequences MSYYFAIVGTQDNPLFEHEFGTSKQGGDGQSRFSDQVRHLNQFILHSSLDIAEEVQWSHGQMYLKCIDKFFNNYISCFRHRRQRQISPAPSTHHPDRNIITVINCHRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.17
4 0.17
5 0.14
6 0.16
7 0.16
8 0.2
9 0.18
10 0.15
11 0.15
12 0.17
13 0.17
14 0.2
15 0.21
16 0.2
17 0.2
18 0.22
19 0.22
20 0.2
21 0.23
22 0.2
23 0.28
24 0.29
25 0.31
26 0.3
27 0.3
28 0.31
29 0.28
30 0.26
31 0.19
32 0.15
33 0.12
34 0.11
35 0.1
36 0.09
37 0.07
38 0.06
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.08
47 0.09
48 0.09
49 0.13
50 0.16
51 0.21
52 0.21
53 0.21
54 0.2
55 0.21
56 0.26
57 0.24
58 0.29
59 0.25
60 0.27
61 0.31
62 0.34
63 0.37
64 0.38
65 0.39
66 0.41
67 0.47
68 0.57
69 0.61
70 0.67
71 0.72
72 0.77
73 0.82
74 0.79
75 0.76
76 0.7
77 0.66
78 0.63
79 0.6
80 0.56
81 0.51
82 0.48
83 0.47
84 0.47
85 0.45
86 0.38
87 0.33
88 0.33