Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2X966

Protein Details
Accession A0A0D2X966    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-133LRPNCRSRYRCRRRAWPHAPLYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, extr 6, mito 3, cyto 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029020  Ammonium/urea_transptr  
IPR001905  Ammonium_transpt  
IPR024041  NH4_transpt_AmtB-like_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0008519  F:ammonium transmembrane transporter activity  
Pfam View protein in Pfam  
PF00909  Ammonium_transp  
Amino Acid Sequences MDVNIWYEPGDIAWMLSATALVLLMIPGVGFFYSGLARRKSALSLIWLSVMSAAVTTFQWFFWGFSLTFSHTAGPFIGDLANFGVPRCPGPALGWFRTSPRYALRRLPGHVLRPNCRSRYRCRRRAWPHAPLYYLHLRVGHCRVRPHRLLDLEPQWLVQQDGRPRFCWRYPCAHRFWKRCSGLFHDAGQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.04
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.05
20 0.07
21 0.12
22 0.17
23 0.18
24 0.19
25 0.21
26 0.22
27 0.22
28 0.23
29 0.2
30 0.2
31 0.2
32 0.2
33 0.19
34 0.18
35 0.17
36 0.15
37 0.13
38 0.08
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.09
49 0.09
50 0.11
51 0.1
52 0.11
53 0.13
54 0.14
55 0.15
56 0.14
57 0.15
58 0.12
59 0.13
60 0.11
61 0.1
62 0.08
63 0.07
64 0.07
65 0.05
66 0.06
67 0.06
68 0.07
69 0.06
70 0.06
71 0.07
72 0.07
73 0.08
74 0.09
75 0.08
76 0.07
77 0.08
78 0.15
79 0.19
80 0.21
81 0.22
82 0.21
83 0.22
84 0.25
85 0.24
86 0.19
87 0.21
88 0.23
89 0.24
90 0.29
91 0.34
92 0.35
93 0.36
94 0.41
95 0.38
96 0.41
97 0.43
98 0.42
99 0.41
100 0.45
101 0.49
102 0.47
103 0.51
104 0.49
105 0.55
106 0.61
107 0.67
108 0.7
109 0.71
110 0.78
111 0.79
112 0.86
113 0.84
114 0.83
115 0.8
116 0.74
117 0.68
118 0.57
119 0.54
120 0.48
121 0.41
122 0.32
123 0.27
124 0.24
125 0.28
126 0.34
127 0.34
128 0.31
129 0.39
130 0.44
131 0.49
132 0.53
133 0.54
134 0.54
135 0.52
136 0.52
137 0.51
138 0.5
139 0.45
140 0.4
141 0.35
142 0.29
143 0.26
144 0.23
145 0.18
146 0.2
147 0.25
148 0.34
149 0.36
150 0.38
151 0.44
152 0.48
153 0.51
154 0.54
155 0.5
156 0.53
157 0.6
158 0.65
159 0.67
160 0.71
161 0.76
162 0.76
163 0.79
164 0.78
165 0.75
166 0.72
167 0.7
168 0.68
169 0.67
170 0.62