Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Y985

Protein Details
Accession A0A0D2Y985    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-96KTAASKPKTTKSKTSKPKKVSKPKASKPKASKPKSTTHydrophilic
NLS Segment(s)
PositionSequence
64-93SKPKTTKSKTSKPKKVSKPKASKPKASKPK
Subcellular Location(s) extr 15, mito 8.5, cyto_mito 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036749  Expansin_CBD_sf  
IPR036908  RlpA-like_sf  
CDD cd22271  DPBB_EXP_N-like  
Amino Acid Sequences MKFFLPILLAAPAVMGRACKVRHSHSSAVEAVHTQYPVPEPVISQAPQVVGQKSSPVEVKTAASKPKTTKSKTSKPKKVSKPKASKPKASKPKSTTTTKPSTPKTSTPSTGSSSKSTPLGDGASVSGSSTFYGGNLAGGNCMFSTYTLPSGILGTAFSGQKWDNSANCGACIEIVDKCPECDPGHLDLFPDAFKAVGGTDGIVKTSYKFVECGITTPLVLHNKEGTSANWFSIQVVNANEPVKSVQVSTDGGSTWKSTERKDYNFFENPAGFGKTSVDVKVTSSTGKSVVVKNVGVTAGAQYKASSNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.14
5 0.15
6 0.2
7 0.26
8 0.32
9 0.41
10 0.48
11 0.53
12 0.51
13 0.55
14 0.52
15 0.47
16 0.42
17 0.34
18 0.29
19 0.25
20 0.21
21 0.15
22 0.15
23 0.16
24 0.17
25 0.17
26 0.15
27 0.13
28 0.16
29 0.21
30 0.2
31 0.18
32 0.18
33 0.17
34 0.2
35 0.23
36 0.22
37 0.18
38 0.18
39 0.21
40 0.2
41 0.22
42 0.21
43 0.19
44 0.19
45 0.19
46 0.21
47 0.23
48 0.28
49 0.32
50 0.31
51 0.36
52 0.39
53 0.47
54 0.55
55 0.54
56 0.6
57 0.63
58 0.71
59 0.76
60 0.82
61 0.83
62 0.83
63 0.88
64 0.89
65 0.9
66 0.91
67 0.91
68 0.91
69 0.91
70 0.93
71 0.9
72 0.89
73 0.87
74 0.87
75 0.86
76 0.82
77 0.82
78 0.76
79 0.79
80 0.76
81 0.73
82 0.69
83 0.66
84 0.67
85 0.63
86 0.65
87 0.6
88 0.61
89 0.59
90 0.57
91 0.54
92 0.52
93 0.49
94 0.45
95 0.43
96 0.39
97 0.39
98 0.36
99 0.33
100 0.29
101 0.27
102 0.26
103 0.22
104 0.19
105 0.16
106 0.14
107 0.11
108 0.1
109 0.09
110 0.08
111 0.07
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.04
119 0.05
120 0.05
121 0.05
122 0.06
123 0.05
124 0.05
125 0.05
126 0.06
127 0.05
128 0.05
129 0.04
130 0.04
131 0.06
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.07
139 0.06
140 0.05
141 0.04
142 0.06
143 0.06
144 0.06
145 0.07
146 0.07
147 0.08
148 0.1
149 0.12
150 0.1
151 0.13
152 0.16
153 0.14
154 0.14
155 0.14
156 0.11
157 0.09
158 0.09
159 0.08
160 0.07
161 0.07
162 0.1
163 0.1
164 0.1
165 0.11
166 0.14
167 0.13
168 0.14
169 0.16
170 0.18
171 0.19
172 0.19
173 0.19
174 0.16
175 0.16
176 0.14
177 0.11
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.06
187 0.06
188 0.07
189 0.07
190 0.08
191 0.08
192 0.11
193 0.11
194 0.1
195 0.11
196 0.11
197 0.16
198 0.16
199 0.17
200 0.16
201 0.16
202 0.15
203 0.15
204 0.19
205 0.19
206 0.19
207 0.19
208 0.19
209 0.18
210 0.2
211 0.21
212 0.17
213 0.18
214 0.19
215 0.18
216 0.18
217 0.17
218 0.17
219 0.18
220 0.18
221 0.15
222 0.15
223 0.16
224 0.17
225 0.18
226 0.17
227 0.15
228 0.15
229 0.14
230 0.13
231 0.11
232 0.09
233 0.12
234 0.13
235 0.13
236 0.13
237 0.12
238 0.13
239 0.13
240 0.13
241 0.12
242 0.18
243 0.2
244 0.21
245 0.32
246 0.38
247 0.44
248 0.51
249 0.54
250 0.55
251 0.58
252 0.58
253 0.52
254 0.46
255 0.4
256 0.36
257 0.34
258 0.26
259 0.2
260 0.2
261 0.18
262 0.2
263 0.19
264 0.18
265 0.16
266 0.17
267 0.2
268 0.2
269 0.19
270 0.18
271 0.19
272 0.18
273 0.22
274 0.24
275 0.24
276 0.29
277 0.31
278 0.3
279 0.29
280 0.3
281 0.27
282 0.23
283 0.19
284 0.17
285 0.18
286 0.18
287 0.17
288 0.16