Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2Y5N9

Protein Details
Accession A0A0D2Y5N9    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25REGGKVKPLKQAKKAQKDLDBasic
NLS Segment(s)
PositionSequence
33-68EKKRADEKARKELAAKAGGKGPLNTGGQGIKKSGKK
Subcellular Location(s) nucl 13, mito 10, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG fox:FOXG_11595  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MGGTNREGGKVKPLKQAKKAQKDLDDDDKAFLEKKRADEKARKELAAKAGGKGPLNTGGQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.74
4 0.74
5 0.77
6 0.8
7 0.77
8 0.74
9 0.72
10 0.69
11 0.67
12 0.59
13 0.49
14 0.42
15 0.36
16 0.3
17 0.26
18 0.21
19 0.18
20 0.17
21 0.21
22 0.26
23 0.31
24 0.36
25 0.43
26 0.49
27 0.54
28 0.55
29 0.51
30 0.47
31 0.46
32 0.46
33 0.45
34 0.39
35 0.3
36 0.31
37 0.33
38 0.32
39 0.29
40 0.25
41 0.23
42 0.23
43 0.22
44 0.2
45 0.21
46 0.23
47 0.24
48 0.25