Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Y973

Protein Details
Accession A0A0D2Y973    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
529-554DGTPKVISKKELKKLRKAEEKATPSKHydrophilic
560-593EETDGKKKRKHDDSEDEEPKKEKKQKKKKRHSEABasic
NLS Segment(s)
PositionSequence
460-466KKLKKAK
535-592ISKKELKKLRKAEEKATPSKSQPAAEETDGKKKRKHDDSEDEEPKKEKKQKKKKRHSE
Subcellular Location(s) cyto 13, cyto_nucl 12.999, nucl 11.5, cyto_mito 7.999, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR045056  Nop56/Nop58  
IPR012974  NOP58/56_N  
IPR042239  Nop_C  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
IPR012976  NOSIC  
Gene Ontology GO:0031428  C:box C/D RNP complex  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0030515  F:snoRNA binding  
GO:0017069  F:snRNA binding  
GO:0000494  P:box C/D RNA 3'-end processing  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:1902570  P:protein localization to nucleolus  
GO:0000452  P:snoRNA guided rRNA 2'-O-methylation  
KEGG fox:FOXG_12843  -  
Pfam View protein in Pfam  
PF01798  Nop  
PF08156  NOP5NT  
PROSITE View protein in PROSITE  
PS51358  NOP  
Amino Acid Sequences MSLFVLAETPAGYGLFKATDKKMLKNEELAAELGRPEKVVEMLKLKKFVKFDSAATALEEAASLKEGKVPELLTQLLDDLKSEKKASLAVADMKLGTAISNMPSLNISPVSGSNTMDLFRGIRGGLPNLIPGLLEENFDRMALGLSHSMSRHKLKFSADKVDSMIIQAIKLLDDLDKELNVYAMRTKEWYGWHFPEMAKILNDNLAYARVILAVGMRTNIADSDLSEILPEEIETSIKAAAEISMGTEITDEDLDNIKLLADQVIVYSNYRTQLSSYLESRMRAIAPNLTALVGYLVGARLIAHAGSLISLAKSPGSTIQILGAEKALFRALKTKHDTPKYGLIYHSSLIGQATGRNKGKIARMLSAKAALGLRVDALGDAEDDADEEERAILGLSNRIKLENHLRKLEGKPLLPKGANVTPSGEIVGAGQFTLKETRRYNGDADGVADDEETNEATPAKKLKKAKKLIEEVDEEMKDAEDDSDDEAATPGKPKKLSEADYERLAEEAGISVKKFKRKYERGDVELNADGTPKVISKKELKKLRKAEEKATPSKSQPAAEETDGKKKRKHDDSEDEEPKKEKKQKKKKRHSEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.17
5 0.19
6 0.28
7 0.32
8 0.39
9 0.46
10 0.51
11 0.53
12 0.54
13 0.55
14 0.49
15 0.47
16 0.41
17 0.33
18 0.27
19 0.24
20 0.2
21 0.16
22 0.14
23 0.12
24 0.12
25 0.15
26 0.18
27 0.2
28 0.28
29 0.35
30 0.4
31 0.47
32 0.47
33 0.48
34 0.48
35 0.47
36 0.46
37 0.42
38 0.39
39 0.38
40 0.4
41 0.35
42 0.33
43 0.31
44 0.22
45 0.19
46 0.17
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.11
53 0.12
54 0.13
55 0.15
56 0.16
57 0.17
58 0.2
59 0.2
60 0.17
61 0.17
62 0.17
63 0.15
64 0.14
65 0.12
66 0.12
67 0.15
68 0.17
69 0.18
70 0.18
71 0.18
72 0.2
73 0.2
74 0.2
75 0.21
76 0.23
77 0.23
78 0.23
79 0.22
80 0.2
81 0.19
82 0.16
83 0.11
84 0.07
85 0.07
86 0.07
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.13
93 0.12
94 0.11
95 0.1
96 0.11
97 0.15
98 0.15
99 0.16
100 0.15
101 0.15
102 0.15
103 0.14
104 0.14
105 0.11
106 0.1
107 0.1
108 0.09
109 0.11
110 0.12
111 0.14
112 0.15
113 0.15
114 0.15
115 0.14
116 0.14
117 0.11
118 0.1
119 0.12
120 0.1
121 0.1
122 0.1
123 0.11
124 0.12
125 0.12
126 0.11
127 0.08
128 0.08
129 0.07
130 0.09
131 0.08
132 0.09
133 0.11
134 0.12
135 0.14
136 0.18
137 0.25
138 0.27
139 0.28
140 0.31
141 0.35
142 0.43
143 0.46
144 0.51
145 0.46
146 0.44
147 0.43
148 0.4
149 0.34
150 0.26
151 0.24
152 0.14
153 0.12
154 0.11
155 0.1
156 0.09
157 0.09
158 0.09
159 0.06
160 0.07
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.1
167 0.09
168 0.09
169 0.1
170 0.1
171 0.11
172 0.13
173 0.14
174 0.16
175 0.2
176 0.23
177 0.27
178 0.29
179 0.29
180 0.3
181 0.29
182 0.3
183 0.27
184 0.25
185 0.19
186 0.17
187 0.16
188 0.16
189 0.16
190 0.12
191 0.11
192 0.1
193 0.1
194 0.09
195 0.09
196 0.06
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.06
208 0.05
209 0.05
210 0.09
211 0.09
212 0.09
213 0.09
214 0.09
215 0.08
216 0.08
217 0.07
218 0.04
219 0.04
220 0.05
221 0.05
222 0.05
223 0.06
224 0.06
225 0.06
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.04
239 0.05
240 0.07
241 0.07
242 0.07
243 0.07
244 0.06
245 0.06
246 0.06
247 0.05
248 0.04
249 0.04
250 0.04
251 0.06
252 0.06
253 0.07
254 0.07
255 0.08
256 0.09
257 0.1
258 0.1
259 0.09
260 0.13
261 0.16
262 0.18
263 0.18
264 0.21
265 0.22
266 0.22
267 0.22
268 0.19
269 0.16
270 0.15
271 0.14
272 0.12
273 0.11
274 0.11
275 0.11
276 0.09
277 0.09
278 0.08
279 0.07
280 0.04
281 0.04
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.06
303 0.08
304 0.08
305 0.08
306 0.09
307 0.11
308 0.11
309 0.11
310 0.1
311 0.08
312 0.08
313 0.08
314 0.08
315 0.06
316 0.06
317 0.13
318 0.14
319 0.22
320 0.28
321 0.35
322 0.42
323 0.46
324 0.49
325 0.45
326 0.52
327 0.48
328 0.43
329 0.36
330 0.31
331 0.28
332 0.26
333 0.23
334 0.14
335 0.12
336 0.1
337 0.11
338 0.08
339 0.09
340 0.12
341 0.18
342 0.19
343 0.19
344 0.2
345 0.23
346 0.27
347 0.3
348 0.3
349 0.29
350 0.3
351 0.31
352 0.31
353 0.29
354 0.25
355 0.21
356 0.18
357 0.13
358 0.1
359 0.09
360 0.08
361 0.06
362 0.06
363 0.04
364 0.04
365 0.04
366 0.04
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.04
378 0.04
379 0.05
380 0.05
381 0.1
382 0.12
383 0.14
384 0.15
385 0.16
386 0.16
387 0.19
388 0.3
389 0.34
390 0.38
391 0.38
392 0.4
393 0.44
394 0.46
395 0.5
396 0.44
397 0.37
398 0.39
399 0.4
400 0.44
401 0.39
402 0.38
403 0.35
404 0.35
405 0.33
406 0.28
407 0.26
408 0.21
409 0.21
410 0.21
411 0.15
412 0.11
413 0.09
414 0.09
415 0.06
416 0.05
417 0.05
418 0.05
419 0.06
420 0.13
421 0.14
422 0.2
423 0.22
424 0.25
425 0.29
426 0.32
427 0.33
428 0.3
429 0.31
430 0.25
431 0.25
432 0.22
433 0.18
434 0.15
435 0.14
436 0.09
437 0.07
438 0.07
439 0.06
440 0.06
441 0.06
442 0.06
443 0.07
444 0.1
445 0.17
446 0.21
447 0.27
448 0.37
449 0.46
450 0.56
451 0.65
452 0.71
453 0.74
454 0.79
455 0.78
456 0.75
457 0.69
458 0.62
459 0.58
460 0.49
461 0.39
462 0.3
463 0.25
464 0.19
465 0.15
466 0.12
467 0.07
468 0.07
469 0.09
470 0.09
471 0.09
472 0.09
473 0.09
474 0.1
475 0.1
476 0.15
477 0.17
478 0.22
479 0.24
480 0.24
481 0.33
482 0.4
483 0.43
484 0.47
485 0.51
486 0.5
487 0.52
488 0.53
489 0.44
490 0.36
491 0.32
492 0.22
493 0.14
494 0.12
495 0.1
496 0.1
497 0.11
498 0.18
499 0.23
500 0.31
501 0.35
502 0.43
503 0.51
504 0.6
505 0.69
506 0.73
507 0.78
508 0.75
509 0.78
510 0.7
511 0.63
512 0.57
513 0.48
514 0.36
515 0.28
516 0.22
517 0.16
518 0.15
519 0.13
520 0.15
521 0.16
522 0.22
523 0.31
524 0.41
525 0.51
526 0.6
527 0.66
528 0.73
529 0.8
530 0.85
531 0.86
532 0.81
533 0.8
534 0.8
535 0.81
536 0.79
537 0.76
538 0.7
539 0.63
540 0.66
541 0.61
542 0.54
543 0.48
544 0.44
545 0.43
546 0.41
547 0.46
548 0.41
549 0.48
550 0.53
551 0.55
552 0.55
553 0.58
554 0.65
555 0.67
556 0.72
557 0.72
558 0.76
559 0.79
560 0.85
561 0.87
562 0.8
563 0.73
564 0.68
565 0.62
566 0.62
567 0.63
568 0.62
569 0.63
570 0.71
571 0.79
572 0.86
573 0.93