Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3S4K0

Protein Details
Accession E3S4K0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
198-217QKPQPTKESKPQPPKKESKPBasic
NLS Segment(s)
PositionSequence
198-241QKPQPTKESKPQPPKKESKPQDEPKPATPGSREERRVKMNRMRL
Subcellular Location(s) mito 26.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003016  2-oxoA_DH_lipoyl-BS  
IPR001078  2-oxoacid_DH_actylTfrase  
IPR000089  Biotin_lipoyl  
IPR023213  CAT-like_dom_sf  
IPR011053  Single_hybrid_motif  
IPR006255  SucB  
Gene Ontology GO:0045252  C:oxoglutarate dehydrogenase complex  
GO:0004149  F:dihydrolipoyllysine-residue succinyltransferase activity  
GO:0033512  P:L-lysine catabolic process to acetyl-CoA via saccharopine  
GO:0006099  P:tricarboxylic acid cycle  
KEGG pte:PTT_17481  -  
Pfam View protein in Pfam  
PF00198  2-oxoacid_dh  
PF00364  Biotin_lipoyl  
PROSITE View protein in PROSITE  
PS50968  BIOTINYL_LIPOYL  
PS00189  LIPOYL  
CDD cd06849  lipoyl_domain  
Amino Acid Sequences MSGQQCLRRLPAAMRSVRALRAAPRTIPAARTYSAITKANSSGLLGQSSRRPGQLSSQRLWTLEQTRNYADTVVKVPEMAESITEGTLKQWSKQVGDYVEQDEEIATIETDKIDVAVNAPEAGTIKEFLVNEEDTVTVGQEIVRLEAGGEAPAKTEAKDEPKEPASSEQETSSQPEGQQEKSEAPKEESKPEPTKQEQKPQPTKESKPQPPKKESKPQDEPKPATPGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSIMEFRKLYKDEILKNKGVKLGFMSAFSRACILAARDVPAVNASIEGPDGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESLDMVGIEKAIADLGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKEKPVAINGKVEIRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRKMLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.47
4 0.47
5 0.45
6 0.39
7 0.36
8 0.41
9 0.42
10 0.39
11 0.38
12 0.41
13 0.4
14 0.4
15 0.37
16 0.33
17 0.3
18 0.29
19 0.3
20 0.3
21 0.33
22 0.34
23 0.31
24 0.31
25 0.31
26 0.31
27 0.28
28 0.24
29 0.22
30 0.2
31 0.22
32 0.19
33 0.21
34 0.24
35 0.3
36 0.31
37 0.29
38 0.29
39 0.28
40 0.37
41 0.44
42 0.45
43 0.42
44 0.48
45 0.47
46 0.46
47 0.47
48 0.43
49 0.41
50 0.42
51 0.43
52 0.4
53 0.41
54 0.41
55 0.4
56 0.35
57 0.28
58 0.24
59 0.23
60 0.2
61 0.18
62 0.17
63 0.16
64 0.15
65 0.15
66 0.13
67 0.1
68 0.09
69 0.1
70 0.1
71 0.11
72 0.09
73 0.09
74 0.15
75 0.16
76 0.16
77 0.2
78 0.22
79 0.24
80 0.27
81 0.31
82 0.27
83 0.3
84 0.31
85 0.29
86 0.27
87 0.24
88 0.22
89 0.17
90 0.14
91 0.11
92 0.09
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.05
100 0.06
101 0.06
102 0.06
103 0.07
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.08
111 0.08
112 0.08
113 0.11
114 0.11
115 0.11
116 0.14
117 0.14
118 0.13
119 0.13
120 0.13
121 0.1
122 0.1
123 0.09
124 0.06
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.07
139 0.09
140 0.09
141 0.09
142 0.1
143 0.13
144 0.19
145 0.22
146 0.22
147 0.26
148 0.29
149 0.29
150 0.29
151 0.31
152 0.28
153 0.28
154 0.28
155 0.24
156 0.24
157 0.24
158 0.26
159 0.23
160 0.19
161 0.17
162 0.22
163 0.23
164 0.22
165 0.23
166 0.21
167 0.22
168 0.25
169 0.28
170 0.24
171 0.25
172 0.31
173 0.32
174 0.36
175 0.37
176 0.4
177 0.41
178 0.42
179 0.46
180 0.44
181 0.52
182 0.51
183 0.58
184 0.57
185 0.62
186 0.69
187 0.67
188 0.71
189 0.69
190 0.68
191 0.67
192 0.71
193 0.7
194 0.72
195 0.75
196 0.75
197 0.76
198 0.8
199 0.79
200 0.8
201 0.78
202 0.76
203 0.78
204 0.77
205 0.78
206 0.78
207 0.73
208 0.65
209 0.64
210 0.54
211 0.46
212 0.39
213 0.35
214 0.33
215 0.37
216 0.39
217 0.38
218 0.42
219 0.48
220 0.52
221 0.54
222 0.55
223 0.58
224 0.59
225 0.59
226 0.57
227 0.52
228 0.52
229 0.52
230 0.49
231 0.46
232 0.43
233 0.45
234 0.45
235 0.43
236 0.39
237 0.36
238 0.33
239 0.28
240 0.25
241 0.18
242 0.17
243 0.15
244 0.15
245 0.11
246 0.1
247 0.09
248 0.08
249 0.08
250 0.07
251 0.07
252 0.07
253 0.06
254 0.08
255 0.08
256 0.08
257 0.09
258 0.1
259 0.15
260 0.16
261 0.17
262 0.21
263 0.26
264 0.32
265 0.42
266 0.46
267 0.44
268 0.44
269 0.45
270 0.43
271 0.37
272 0.31
273 0.23
274 0.23
275 0.2
276 0.2
277 0.19
278 0.17
279 0.18
280 0.17
281 0.16
282 0.1
283 0.1
284 0.09
285 0.1
286 0.11
287 0.12
288 0.13
289 0.13
290 0.13
291 0.13
292 0.13
293 0.12
294 0.09
295 0.08
296 0.06
297 0.06
298 0.06
299 0.06
300 0.05
301 0.05
302 0.05
303 0.04
304 0.04
305 0.04
306 0.05
307 0.06
308 0.06
309 0.06
310 0.06
311 0.07
312 0.08
313 0.08
314 0.06
315 0.06
316 0.06
317 0.06
318 0.06
319 0.05
320 0.05
321 0.06
322 0.05
323 0.05
324 0.06
325 0.06
326 0.07
327 0.1
328 0.13
329 0.16
330 0.16
331 0.17
332 0.17
333 0.19
334 0.18
335 0.15
336 0.12
337 0.08
338 0.08
339 0.08
340 0.07
341 0.05
342 0.04
343 0.04
344 0.04
345 0.04
346 0.05
347 0.09
348 0.13
349 0.19
350 0.22
351 0.27
352 0.35
353 0.4
354 0.43
355 0.44
356 0.47
357 0.44
358 0.42
359 0.38
360 0.32
361 0.26
362 0.23
363 0.18
364 0.11
365 0.08
366 0.08
367 0.06
368 0.06
369 0.06
370 0.05
371 0.05
372 0.06
373 0.05
374 0.05
375 0.05
376 0.05
377 0.05
378 0.06
379 0.06
380 0.05
381 0.06
382 0.07
383 0.09
384 0.08
385 0.08
386 0.08
387 0.09
388 0.1
389 0.1
390 0.09
391 0.07
392 0.09
393 0.1
394 0.12
395 0.14
396 0.14
397 0.14
398 0.16
399 0.17
400 0.17
401 0.23
402 0.25
403 0.23
404 0.28
405 0.3
406 0.36
407 0.35
408 0.35
409 0.31
410 0.27
411 0.26
412 0.21
413 0.2
414 0.13
415 0.12
416 0.12
417 0.14
418 0.14
419 0.16
420 0.18
421 0.16
422 0.17
423 0.18
424 0.18
425 0.2
426 0.24
427 0.22
428 0.21
429 0.21
430 0.21
431 0.22
432 0.21
433 0.17
434 0.17
435 0.17
436 0.17
437 0.17
438 0.21
439 0.21
440 0.31
441 0.38
442 0.38