Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XJ18

Protein Details
Accession A0A0D2XJ18    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
285-305RSKSHRSPLGRYEPRREHRLEBasic
NLS Segment(s)
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007568  RTA1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04479  RTA1  
Amino Acid Sequences MSNDQRERCEKISPDCPLEDTIYGYVPNMGGNAFFGVVFGICTLVQVYFLIRYWRLWKGYTILVLLGSLIECCGYAGRILMSKNPWDGAATSIQFVLLMVGPSFLAAALYMTLRALVQYFGEQYTKLPARLWTWPFVTADMLGFFSQCVGGIMASMTEKYPAVGTAGRAVMVFGVSFQAVVMAIAGILATDFALRMRRQRGSVFRNLPKDLNIFLISLTVVFLLILTRCIYRIPELAGGVGGHMMRQEVEFMILDGCMIAISVLLLSVTHPGIYATAIHGRADHRSKSHRSPLGRYEPRREHRLEPSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.5
3 0.5
4 0.44
5 0.42
6 0.34
7 0.28
8 0.23
9 0.2
10 0.19
11 0.17
12 0.15
13 0.12
14 0.11
15 0.09
16 0.08
17 0.07
18 0.07
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.06
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.08
36 0.1
37 0.13
38 0.13
39 0.16
40 0.2
41 0.26
42 0.27
43 0.27
44 0.28
45 0.28
46 0.3
47 0.3
48 0.26
49 0.2
50 0.18
51 0.16
52 0.14
53 0.1
54 0.07
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.09
66 0.1
67 0.13
68 0.16
69 0.18
70 0.19
71 0.19
72 0.18
73 0.17
74 0.17
75 0.15
76 0.17
77 0.15
78 0.14
79 0.13
80 0.13
81 0.12
82 0.11
83 0.09
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.06
107 0.07
108 0.08
109 0.08
110 0.08
111 0.14
112 0.15
113 0.15
114 0.15
115 0.17
116 0.19
117 0.26
118 0.27
119 0.24
120 0.24
121 0.25
122 0.24
123 0.23
124 0.21
125 0.14
126 0.12
127 0.09
128 0.09
129 0.07
130 0.06
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.04
149 0.06
150 0.06
151 0.07
152 0.09
153 0.09
154 0.09
155 0.08
156 0.08
157 0.07
158 0.06
159 0.06
160 0.03
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.03
180 0.07
181 0.08
182 0.14
183 0.19
184 0.21
185 0.24
186 0.3
187 0.39
188 0.41
189 0.5
190 0.54
191 0.56
192 0.59
193 0.59
194 0.54
195 0.47
196 0.42
197 0.34
198 0.28
199 0.23
200 0.17
201 0.15
202 0.14
203 0.11
204 0.09
205 0.08
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.05
213 0.06
214 0.07
215 0.07
216 0.08
217 0.1
218 0.11
219 0.13
220 0.15
221 0.16
222 0.17
223 0.16
224 0.16
225 0.15
226 0.12
227 0.11
228 0.09
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.07
235 0.06
236 0.08
237 0.08
238 0.08
239 0.08
240 0.07
241 0.07
242 0.06
243 0.05
244 0.04
245 0.03
246 0.03
247 0.02
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.06
255 0.06
256 0.06
257 0.06
258 0.07
259 0.07
260 0.08
261 0.08
262 0.09
263 0.14
264 0.15
265 0.15
266 0.17
267 0.19
268 0.26
269 0.32
270 0.34
271 0.35
272 0.43
273 0.51
274 0.58
275 0.66
276 0.66
277 0.66
278 0.69
279 0.72
280 0.75
281 0.78
282 0.75
283 0.76
284 0.79
285 0.8
286 0.8
287 0.75
288 0.71
289 0.72