Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XU90

Protein Details
Accession A0A0D2XU90    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-73VRGPKEVTKLLKKKRRTKKEIAAEAEAHydrophilic
NLS Segment(s)
PositionSequence
49-65GPKEVTKLLKKKRRTKK
Subcellular Location(s) nucl 14, mito 8.5, cyto_mito 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MGHLDCWSKHALKGEPKETLLPLSCTCPSCGGKINWSDMMKELTLRVRGPKEVTKLLKKKRRTKKEIAAEAEAEEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.48
4 0.47
5 0.42
6 0.38
7 0.31
8 0.26
9 0.22
10 0.22
11 0.23
12 0.22
13 0.22
14 0.23
15 0.23
16 0.22
17 0.26
18 0.23
19 0.25
20 0.26
21 0.28
22 0.28
23 0.27
24 0.26
25 0.21
26 0.22
27 0.17
28 0.15
29 0.14
30 0.12
31 0.14
32 0.14
33 0.18
34 0.18
35 0.2
36 0.24
37 0.28
38 0.3
39 0.36
40 0.41
41 0.47
42 0.55
43 0.63
44 0.68
45 0.73
46 0.79
47 0.82
48 0.87
49 0.86
50 0.87
51 0.87
52 0.89
53 0.89
54 0.85
55 0.78
56 0.68
57 0.6