Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XBT1

Protein Details
Accession A0A0D2XBT1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-124DETGWRWPTQKRTKNPFANPHQHSPGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MRSGTPTLLVVAPWSSEKTPTWEKAMQEMIVSLAELFKASYISEGDIHVEIVTPEFEQTVYFVAPNDASLHGNWDWYGVIPDPQDNPLIIYISVDFGSDETGWRWPTQKRTKNPFANPHQHSPGNEHQKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.16
4 0.17
5 0.23
6 0.29
7 0.31
8 0.36
9 0.37
10 0.37
11 0.4
12 0.42
13 0.35
14 0.28
15 0.25
16 0.2
17 0.15
18 0.14
19 0.09
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.06
29 0.07
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.05
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.1
58 0.1
59 0.1
60 0.1
61 0.09
62 0.08
63 0.08
64 0.09
65 0.06
66 0.07
67 0.08
68 0.09
69 0.1
70 0.11
71 0.11
72 0.1
73 0.11
74 0.1
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.06
84 0.08
85 0.07
86 0.08
87 0.08
88 0.11
89 0.13
90 0.14
91 0.18
92 0.21
93 0.32
94 0.42
95 0.51
96 0.58
97 0.67
98 0.77
99 0.82
100 0.87
101 0.86
102 0.85
103 0.86
104 0.82
105 0.81
106 0.77
107 0.71
108 0.63
109 0.61
110 0.61